128UP_DROME - dbPTM
128UP_DROME - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 128UP_DROME
UniProt AC P32234
Protein Name GTP-binding protein 128up
Gene Name 128up
Organism Drosophila melanogaster (Fruit fly).
Sequence Length 368
Subcellular Localization
Protein Description Deformed (Dfd) is required to activate 1.28up in maxillary segment cells..
Protein Sequence MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGGGTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLDCLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSELDTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKIDQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKGQLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKVGIEHVLNDEDVVQIVKKV
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster
295PhosphotyrosineYLRLQRIYTKPKGQL
HHHHHHHCCCCCCCC
15.7622817900

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of 128UP_DROME !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of 128UP_DROME !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Related Literatures of Post-Translational Modification

TOP