14331_CAEEL - dbPTM
14331_CAEEL - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 14331_CAEEL
UniProt AC P41932
Protein Name 14-3-3-like protein 1
Gene Name par-5
Organism Caenorhabditis elegans.
Sequence Length 248
Subcellular Localization Cytoplasm . Nucleus .
Protein Description
Protein Sequence MSDTVEELVQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQLAKEYRVKVEQELNDICQDVLKLLDEFLIVKAGAAESKVFYLKMKGDYYRYLAEVASEDRAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVGAEDQEQEGNQEAGN
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster
2Phosphoserine------MSDTVEELV
------CCHHHHHHH
41.8219530675
47PhosphoserineNEERNLLSVAYKNVV
HHHHHHHHHHHHHHH
14.1019530675
21081558
18806794
66PhosphoserineSSWRVISSIEQKTEG
HHHHHHHHHHHHCCC
21.0119530675
21081558
18806794

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of 14331_CAEEL !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of 14331_CAEEL !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Related Literatures of Post-Translational Modification

TOP