14331_CAEEL - dbPTM
14331_CAEEL - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 14331_CAEEL
UniProt AC P41932
Protein Name 14-3-3-like protein 1
Gene Name par-5
Organism Caenorhabditis elegans.
Sequence Length 248
Subcellular Localization Cytoplasm . Nucleus .
Protein Description
Protein Sequence MSDTVEELVQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQLAKEYRVKVEQELNDICQDVLKLLDEFLIVKAGAAESKVFYLKMKGDYYRYLAEVASEDRAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVGAEDQEQEGNQEAGN
Overview of Protein Modification Sites with Functional and Structural Information