14331_SOLLC - dbPTM
14331_SOLLC - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 14331_SOLLC
UniProt AC P93206
Protein Name 14-3-3 protein 1
Gene Name TFT1
Organism Solanum lycopersicum (Tomato) (Lycopersicon esculentum).
Sequence Length 249
Subcellular Localization
Protein Description
Protein Sequence MALPENLTREQCLYLAKLAEQAERYEEMVKFMDKLVIGSGSSELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEEGRKNDEHVVLVKDYRSKVESELSDVCAGILKILDQYLIPSASAGESKVFYLKMKGDYYRYLAEFKVGNERKEAAEDTMLAYKAAQDIAVAELAPTHPIRLGLALNFSVFYYEILNASEKACSMAKQAFEEAIAELDTMGEESYKDSTLIMQLLRDNLTLWTSDMQEQMDEA
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster
130N6-succinyllysineESKVFYLKMKGDYYR
CCEEEEEEECCHHHH
27.4726828863

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of 14331_SOLLC !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of 14331_SOLLC !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Related Literatures of Post-Translational Modification

TOP