14331_SOLLC - dbPTM
14331_SOLLC - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 14331_SOLLC
UniProt AC P93206
Protein Name 14-3-3 protein 1
Gene Name TFT1
Organism Solanum lycopersicum (Tomato) (Lycopersicon esculentum).
Sequence Length 249
Subcellular Localization
Protein Description
Protein Sequence MALPENLTREQCLYLAKLAEQAERYEEMVKFMDKLVIGSGSSELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEEGRKNDEHVVLVKDYRSKVESELSDVCAGILKILDQYLIPSASAGESKVFYLKMKGDYYRYLAEFKVGNERKEAAEDTMLAYKAAQDIAVAELAPTHPIRLGLALNFSVFYYEILNASEKACSMAKQAFEEAIAELDTMGEESYKDSTLIMQLLRDNLTLWTSDMQEQMDEA
Overview of Protein Modification Sites with Functional and Structural Information