14332_CAEEL - dbPTM
14332_CAEEL - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 14332_CAEEL
UniProt AC Q20655
Protein Name 14-3-3-like protein 2
Gene Name ftt-2 {ECO:0000312|WormBase:F52D10.3a}
Organism Caenorhabditis elegans.
Sequence Length 248
Subcellular Localization Cytoplasm . Nucleus .
Protein Description Required for extension of life-span by sir-2.1. [PubMed: 16777605 Promotes nuclear export of yap-1]
Protein Sequence MSDGKEELVNRAKLAEQAERYDDMAASMKKVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQMAKEYREKVEKELRDICQDVLNLLDKFLIPKAGAAESKVFYLKMKGDYYRYLAEVASGDDRNSVVEKSQQSYQEAFDIAKDKMQPTHPIRLGLALNFSVFFYEILNAPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAATDDTDANETEGGN
Overview of Protein Modification Sites with Functional and Structural Information