14332_CAEEL - dbPTM
14332_CAEEL - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 14332_CAEEL
UniProt AC Q20655
Protein Name 14-3-3-like protein 2
Gene Name ftt-2 {ECO:0000312|WormBase:F52D10.3a}
Organism Caenorhabditis elegans.
Sequence Length 248
Subcellular Localization Cytoplasm . Nucleus .
Protein Description Required for extension of life-span by sir-2.1. [PubMed: 16777605 Promotes nuclear export of yap-1]
Protein Sequence MSDGKEELVNRAKLAEQAERYDDMAASMKKVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQMAKEYREKVEKELRDICQDVLNLLDKFLIPKAGAAESKVFYLKMKGDYYRYLAEVASGDDRNSVVEKSQQSYQEAFDIAKDKMQPTHPIRLGLALNFSVFFYEILNAPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAATDDTDANETEGGN
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster
47PhosphoserineNEERNLLSVAYKNVV
HHHHHHHHHHHHHHH
14.1019530675
66PhosphoserineSSWRVISSIEQKTEG
HHHHHHHHHHHHCCC
21.0119530675

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of 14332_CAEEL !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of 14332_CAEEL !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Related Literatures of Post-Translational Modification

TOP