14334_ARATH - dbPTM
14334_ARATH - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 14334_ARATH
UniProt AC P46077
Protein Name 14-3-3-like protein GF14 phi
Gene Name GRF4
Organism Arabidopsis thaliana (Mouse-ear cress).
Sequence Length 267
Subcellular Localization Nucleus . Cytoplasm . Translocates from the cytosol to the nucleus when phosphorylated.
Protein Description Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes..
Protein Sequence MAAPPASSSAREEFVYLAKLAEQAERYEEMVEFMEKVAEAVDKDELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNDDHVTTIRDYRSKIESELSKICDGILKLLDTRLVPASANGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLTAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDESPEEIKEAAAPKPAEEQKEI
Overview of Protein Modification Sites with Functional and Structural Information