14335_ARATH - dbPTM
14335_ARATH - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 14335_ARATH
UniProt AC P42645
Protein Name 14-3-3-like protein GF14 upsilon
Gene Name GRF5
Organism Arabidopsis thaliana (Mouse-ear cress).
Sequence Length 268
Subcellular Localization Cytoplasm . Nucleus . Not associated with microtubules (PubMed:21558460). Translocates from the cytosol to the nucleus when phosphorylated (By similarity).
Protein Description Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes. May be involved in cell cycle regulation by binding to soluble EDE1 and sequestering it in an inactive form during the early stages of mitosis..
Protein Sequence MSSDSSREENVYLAKLAEQAERYEEMVEFMEKVAKTVETEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEDSRGNSDHVSIIKDYRGKIETELSKICDGILNLLEAHLIPAASLAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLVAYKSAQDIALADLAPTHPIRLGLALNFSVFYYEILNSSDRACSLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDLNDEAGDDIKEAPKEVQKVDEQAQPPPSQ
Overview of Protein Modification Sites with Functional and Structural Information