14335_ORYSJ - dbPTM
14335_ORYSJ - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 14335_ORYSJ
UniProt AC Q6EUP4
Protein Name 14-3-3-like protein GF14-E
Gene Name GF14E
Organism Oryza sativa subsp. japonica (Rice).
Sequence Length 262
Subcellular Localization Cytoplasm . Nucleus .
Protein Description Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes..
Protein Sequence MSQPAELSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEDRCTLIKEYRGKIETELSKICDGILKLLDSHLVPSSTAPESKVFYLKMKGDYYRYLAEFKTGAERKDAAENTMVAYKAAQDIALAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDISEDAAEEIKEAPKGESGDGQ
Overview of Protein Modification Sites with Functional and Structural Information