14336_ARATH - dbPTM
14336_ARATH - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 14336_ARATH
UniProt AC P48349
Protein Name 14-3-3-like protein GF14 lambda
Gene Name GRF6
Organism Arabidopsis thaliana (Mouse-ear cress).
Sequence Length 248
Subcellular Localization Nucleus . Cell membrane . Cytoplasm . Translocates from the cytosol to the nucleus when phosphorylated by CRPK1 in response to cold stress.
Protein Description Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes (By similarity). Specific negative regulator of slow-vacuolar (SV) ion channel. Mediates F-actin dynamics possibly through inhibiting ADF1 phosphorylation. [PubMed: 26345162 Negative regulator of freezing tolerance that modulates cold-responsive C-repeat-binding factors (CBF) DREB1A AND DREB1B proteins stability by facilitating their ubiquitin-mediated degradation when activated by CRPK1-mediated phosophorylation in freezing conditions]
Protein Sequence MAATLGRDQYVYMAKLAEQAERYEEMVQFMEQLVTGATPAEELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEESRKNDEHVSLVKDYRSKVESELSSVCSGILKLLDSHLIPSAGASESKVFYLKMKGDYHRYMAEFKSGDERKTAAEDTMLAYKAAQDIAAADMAPTHPIRLGLALNFSVFYYEILNSSDKACNMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQEQMDEA
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster
70PhosphoserineRAAWRIVSSIEQKEE
HHHHHHHHHHHHHHH
24.1928344081
112PhosphoserineGILKLLDSHLIPSAG
HHHHHHHHCCCCCCC
21.8428344081
193PhosphoserineFYYEILNSSDKACNM
HHHHHHCCCHHHHHH
36.1528344081
214PhosphothreonineEAIAELDTLGEESYK
HHHHHHHCCCCHHHC
49.6528344081

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of 14336_ARATH !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions
SERK1_ARATHSERK1physical
15592873
CD48A_ARATHCDC48physical
15592873
BZR1_ARATHBZR1physical
17681130
BZR2_ARATHBES1physical
17681130
OMT1_ARATHOMT1physical
9349713
APX3_ARATHAPX3physical
9290648
FB316_ARATHAT1G61340physical
22920997
KCO1_ARATHATKCO1physical
25189593
14333_ARATHGRF3physical
10622729
14336_ARATHGRF6physical
10622729
ADF1_ARATHADF1physical
26345162
ADF1_ARATHADF1genetic
26345162

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Related Literatures of Post-Translational Modification

TOP