14336_ORYSJ - dbPTM
14336_ORYSJ - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 14336_ORYSJ
UniProt AC Q06967
Protein Name 14-3-3-like protein GF14-F
Gene Name GF14F
Organism Oryza sativa subsp. japonica (Rice).
Sequence Length 260
Subcellular Localization Cytoplasm. Nucleus.
Protein Description Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes..
Protein Sequence MSPAEASREENVYMAKLAEQAERYEEMVEFMEKVAKTTDVGELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEAYVASIKEYRSRIETELSKICDGILKLLDSHLVPSATAAESKVFYLKMKGDYHRYLAEFKSGAERKEAAENTLVAYKSAQDIALADLPTTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDDAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDNAEDGGDEIKEAAKPEGEGH
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster
2Phosphoserine------MSPAEASRE
------CCHHHHHHH
32.5820466843
24243849
7Phosphoserine-MSPAEASREENVYM
-CCHHHHHHHHHHHH
31.5620466843
24243849
33N6-acetyllysineEMVEFMEKVAKTTDV
HHHHHHHHHHCCCCC
35.3926836501
75N6-succinyllysineIISSIEQKEESRGNE
HHHHHHHHHHHCCCC
51.1326767346
129N6-acetyllysineESKVFYLKMKGDYHR
CCCEEEEEECCCHHH
27.4726836501
131N6-acetyllysineKVFYLKMKGDYHRYL
CEEEEEECCCHHHHH
47.2226836501
239PhosphoserineDNLTLWTSDNAEDGG
CCCEEEECCCCCCCC
19.7920466843
24243849

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of 14336_ORYSJ !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of 14336_ORYSJ !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Related Literatures of Post-Translational Modification

TOP