14337_ARATH - dbPTM
14337_ARATH - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 14337_ARATH
UniProt AC Q96300
Protein Name 14-3-3-like protein GF14 nu
Gene Name GRF7
Organism Arabidopsis thaliana (Mouse-ear cress).
Sequence Length 265
Subcellular Localization Nucleus . Cytoplasm . Translocates from the cytosol to the nucleus when phosphorylated.
Protein Description Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes..
Protein Sequence MSSSREENVYLAKLAEQAERYEEMVEFMEKVAKTVDTDELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNDDHVSIIKDYRGKIETELSKICDGILNLLDSHLVPTASLAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLVAYKSAQDIALADLAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWNSDINDEAGGDEIKEASKHEPEEGKPAETGQ
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster
236PhosphoserineDNLTLWNSDINDEAG
CCCEEECCCCCCCCC
28.4323572148
23111157
20466843
24243849
19880383
251PhosphoserineGDEIKEASKHEPEEG
CHHHHHHHHCCCCCC
35.3222092075

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of 14337_ARATH !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions
AI5L2_ARATHAREB3physical
21798944
CIPKC_ARATHCIPK12physical
21798944

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Related Literatures of Post-Translational Modification

TOP