14339_ARATH - dbPTM
14339_ARATH - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 14339_ARATH
UniProt AC Q96299
Protein Name 14-3-3-like protein GF14 mu
Gene Name GRF9
Organism Arabidopsis thaliana (Mouse-ear cress).
Sequence Length 263
Subcellular Localization Nucleus . Cytoplasm . Translocates from the cytosol to the nucleus when phosphorylated.
Protein Description Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes..
Protein Sequence MGSGKERDTFVYLAKLSEQAERYEEMVESMKSVAKLNVDLTVEERNLLSVGYKNVIGSRRASWRIFSSIEQKEAVKGNDVNVKRIKEYMEKVELELSNICIDIMSVLDEHLIPSASEGESTVFFNKMKGDYYRYLAEFKSGNERKEAADQSLKAYEIATTAAEAKLPPTHPIRLGLALNFSVFYYEIMNAPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTSDISEEGGDDAHKTNGSAKPGAGGDDAE
Overview of Protein Modification Sites with Functional and Structural Information