1A02_HUMAN - dbPTM
1A02_HUMAN - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 1A02_HUMAN
UniProt AC P01892
Protein Name HLA class I histocompatibility antigen, A-2 alpha chain
Gene Name HLA-A
Organism Homo sapiens (Human).
Sequence Length 365
Subcellular Localization Membrane
Single-pass type I membrane protein.
Protein Description Involved in the presentation of foreign antigens to the immune system..
Protein Sequence MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRKGGSYSQAASSDSAQGSDVSLTACKV
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster
110N-linked (GlcNAc)GTLRGYYNQSEAGSH
HHHCCCCCCCCCCCC
30.3419159218
135N6-methyllysineGSDWRFLRGYHQYAY
CCCCHHHCCCEEEEE
40.69115478757
145UbiquitinlysineHQYAYDGKDYIALKE
EEEEECCCCEEEEHH
44.4521906983
21890473
151UbiquitinlysineGKDYIALKEDLRSWT
CCCEEEEHHHHHHCH
39.9121906983
21890473
155N6-methyllysineIALKEDLRSWTAADM
EEEHHHHHHCHHHHH
42.33115478751
168UbiquitinlysineDMAAQTTKHKWEAAH
HHHHHHCHHHHHHHH
46.7221906983
21890473
188 S-glutathionyl cysteineRAYLEGTCVEWLRRY
HHHHHCHHHHHHHHH
3.7222555962
200UbiquitinlysineRRYLENGKETLQRTD
HHHHHCCHHHHHCCC
60.1421906983
21890473
267N6-methyllysineAGDGTFQKWAAVVVP
CCCCCEEEEEEEEEC
34.3124623505
267UbiquitinlysineAGDGTFQKWAAVVVP
CCCCCEEEEEEEEEC
34.3121906983
21890473
292UbiquitinlysineVQHEGLPKPLTLRWE
EEECCCCCCEEEECC
58.6721906983
21890473
340UbiquitinlysineRRKSSDRKGGSYSQA
HCCCCCCCCCCCCCC
73.0321906983
21890473
344PhosphotyrosineSDRKGGSYSQAASSD
CCCCCCCCCCCCCCC
14.211956339
350PhosphoserineSYSQAASSDSAQGSD
CCCCCCCCCCCCCCC
30.7524275569
352PhosphoserineSQAASSDSAQGSDVS
CCCCCCCCCCCCCCE
25.1724275569
356PhosphoserineSSDSAQGSDVSLTAC
CCCCCCCCCCEEEEE
23.8218088087
23186163
24275569
359PhosphoserineSAQGSDVSLTACKV-
CCCCCCCEEEEECC-
25.6223186163
24275569
364UbiquitinlysineDVSLTACKV------
CCEEEEECC------
48.8121906983
21890473

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of 1A02_HUMAN !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions
UGGG1_HUMANUGGT1physical
17353931
CD8A_HUMANCD8Aphysical
9177355
CD8A_HUMANCD8Aphysical
10809759
COPB_HUMANCOPB1physical
11884415
COPG1_HUMANCOPG1physical
11884415
TPSN_HUMANTAPBPphysical
11884415
TAP1_HUMANTAP1physical
11884415
SYVN1_HUMANSYVN1physical
21245296
UB2J1_HUMANUBE2J1physical
21245296
DERL1_HUMANDERL1physical
21245296
PSMD2_HUMANPSMD2physical
21245296
MAGA4_HUMANMAGEA4physical
21815906
BAP31_HUMANBCAP31physical
17056546
B2MG_HUMANB2Mphysical
8805302
STAT3_HUMANSTAT3physical
21988832
GNAS3_HUMANGNASphysical
9914489
GNAS2_HUMANGNASphysical
9914489
ALEX_HUMANGNASphysical
9914489
GNAS1_HUMANGNASphysical
9914489
BAG6_HUMANBAG6physical
21636303
MEOX2_HUMANMEOX2physical
24722188

Drug and Disease Associations
Kegg Disease
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry.";
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
J. Proteome Res. 8:651-661(2009).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-110, AND MASSSPECTROMETRY.
Phosphorylation
ReferencePubMed
"Phosphoproteome of resting human platelets.";
Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J.,Schuetz C., Walter U., Gambaryan S., Sickmann A.;
J. Proteome Res. 7:526-534(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-352 AND SER-356, ANDMASS SPECTROMETRY.
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-352 AND SER-356, ANDMASS SPECTROMETRY.

TOP