2B13_HUMAN - dbPTM
2B13_HUMAN - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 2B13_HUMAN
UniProt AC P01912
Protein Name HLA class II histocompatibility antigen, DRB1-3 chain
Gene Name HLA-DRB1
Organism Homo sapiens (Human).
Sequence Length 266
Subcellular Localization Cell membrane
Single-pass type I membrane protein . Endoplasmic reticulum membrane
Single-pass type I membrane protein . Golgi apparatus, trans-Golgi network membrane
Single-pass type I membrane protein . Endosome membrane
Single-pass type I membr
Protein Description Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route; where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules; and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments; exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides; autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs; other cells of the gastrointestinal tract; such as epithelial cells; express MHC class II molecules and CD74 and act as APCs; which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen; three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs; CD74 undergoes a sequential degradation by various proteases; including CTSS and CTSL; leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells; the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules; increased acidification produces increased proteolysis and efficient peptide loading..
Protein Sequence MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster
48N-linked (GlcNAc)TSECHFFNGTERVRY
CCCCEECCCCHHHHH
56.3819159218

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference
48N-linked Glycosylation54 (6)RQrs17885382
  • Asparaginase hypersensitivity in acute lymphoblastic leukemia:asparaginase hypersensitivity, acute lymphoblastic leukemia
25987655

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions
RO52_HUMANTRIM21physical
18022694
TERA_HUMANVCPphysical
18022694
KPYM_HUMANPKMphysical
20458337
HS90A_HUMANHSP90AA1physical
20458337
HSP7C_HUMANHSPA8physical
20458337
ANX11_HUMANANXA11physical
20458337
HS90B_HUMANHSP90AB1physical
20458337
AT1B1_HUMANATP1B1physical
20458337
1433E_HUMANYWHAEphysical
20458337
CD20_HUMANMS4A1physical
20458337
MAGA3_HUMANMAGEA3physical
12393675
2B1F_HUMANHLA-DRB1physical
26186194
2B13_HUMANHLA-DRB1physical
26186194
2B1G_HUMANHLA-DRB1physical
26186194
DRB5_HUMANHLA-DRB5physical
26186194
PHOP1_HUMANPHOSPHO1physical
26186194
DRB5_HUMANHLA-DRB5physical
28514442
2B1F_HUMANHLA-DRB1physical
28514442
2B13_HUMANHLA-DRB1physical
28514442
2B1G_HUMANHLA-DRB1physical
28514442
EMC6_HUMANEMC6physical
28514442
CNNM1_HUMANCNNM1physical
28514442
ERG1_HUMANSQLEphysical
28514442
E2AK3_HUMANEIF2AK3physical
28514442
RN149_HUMANRNF149physical
28514442
PDE3B_HUMANPDE3Bphysical
28514442
ITA6_HUMANITGA6physical
28514442
K319L_HUMANKIAA0319Lphysical
28514442
SEM4F_HUMANSEMA4Fphysical
28514442
BT2A2_HUMANBTN2A2physical
28514442
CNEP1_HUMANCTDNEP1physical
28514442
IMPA3_HUMANIMPAD1physical
28514442

Drug and Disease Associations
Kegg Disease
H00079 Asthma
H00080 Systemic lupus erythematosus
H00081 Hashimoto's thyroiditis
H00082 Graves' disease
H00294 Dilated cardiomyopathy (DCM)
H00342 Tuberculosis
H00408 Type I diabetes mellitus
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
D02967 Apolizumab (USAN/INN)
DrugBank
There are no disease associations of PTM sites.
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry.";
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
J. Proteome Res. 8:651-661(2009).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-48, AND MASS SPECTROMETRY.

TOP