6PGD_HUMAN - dbPTM
6PGD_HUMAN - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 6PGD_HUMAN
UniProt AC P52209
Protein Name 6-phosphogluconate dehydrogenase, decarboxylating
Gene Name PGD
Organism Homo sapiens (Human).
Sequence Length 483
Subcellular Localization Cytoplasm.
Protein Description Catalyzes the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate and CO(2), with concomitant reduction of NADP to NADPH..
Protein Sequence MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster
25N6-acetyllysineLILNMNDHGFVVCAF
EEEECCCCCEEEEEE
26.9619608861
25UbiquitinlysineLILNMNDHGFVVCAF
EEEECCCCCEEEEEE
26.9619608861
38UbiquitinlysineAFNRTVSKVDDFLAN
EEECCCCCHHHHHHH
45.4021890473
38UbiquitinlysineAFNRTVSKVDDFLAN
EEECCCCCHHHHHHH
45.4021890473
38N6-acetyllysineAFNRTVSKVDDFLAN
EEECCCCCHHHHHHH
45.4019608861
23236377
23749302
23954790
25825284
25953088
26051181
26210075
26822725
27452117
38UbiquitinlysineAFNRTVSKVDDFLAN
EEECCCCCHHHHHHH
45.4021890473
46N6-acetyllysineVDDFLANEAKGTKVV
HHHHHHHCCCCCCEE
46.2619608861
46UbiquitinlysineVDDFLANEAKGTKVV
HHHHHHHCCCCCCEE
46.2619608861
48UbiquitinlysineDFLANEAKGTKVVGA
HHHHHCCCCCCEECC
62.0221906983
59UbiquitinlysineVVGAQSLKEMVSKLK
EECCHHHHHHHHHCC
49.3521890473
59UbiquitinlysineVVGAQSLKEMVSKLK
EECCHHHHHHHHHCC
49.3521890473
59N6-acetyllysineVVGAQSLKEMVSKLK
EECCHHHHHHHHHCC
49.3519608861
59N6-malonyllysineVVGAQSLKEMVSKLK
EECCHHHHHHHHHCC
49.3526320211
63N6-acetyllysineQSLKEMVSKLKKPRR
HHHHHHHHHCCCCCE
30.8419608861
76N6-acetyllysineRRIILLVKAGQAVDD
CEEEEEEECCHHHHH
46.9319608861
25953088
87N6-acetyllysineAVDDFIEKLVPLLDT
HHHHHHHHHHHHHCC
50.3921466224
25038526
104PhosphoserineIIIDGGNSEYRDTTR
EEEECCCHHHCCCCH
39.0022135298
119UbiquitinlysineRCRDLKAKGILFVGS
HHHHHCCCCEEEEEC
44.9221890473
119UbiquitinlysineRCRDLKAKGILFVGS
HHHHHCCCCEEEEEC
44.9221890473
119UbiquitinlysineRCRDLKAKGILFVGS
HHHHHCCCCEEEEEC
44.9221890473
21906983
22053931
21139048
126PhosphoserineKGILFVGSGVSGGEE
CCEEEEECCCCCCCC
30.6222135298
129PhosphoserineLFVGSGVSGGEEGAR
EEEECCCCCCCCCCC
44.6022135298
25627689
141N6-acetyllysineGARYGPSLMPGGNKE
CCCCCCCCCCCCCCC
5.5919608861
141UbiquitinlysineGARYGPSLMPGGNKE
CCCCCCCCCCCCCCC
5.5919608861
147 N-acetyllysineSLMPGGNKEAWPHIK
CCCCCCCCCCCHHHH
52.677430939
154UbiquitinlysineKEAWPHIKTIFQGIA
CCCCHHHHHHHHHHH
32.3121890473
154UbiquitinlysineKEAWPHIKTIFQGIA
CCCCHHHHHHHHHHH
32.3121890473
154N6-acetyllysineKEAWPHIKTIFQGIA
CCCCHHHHHHHHHHH
32.3119608861
23236377
25953088
154UbiquitinlysineKEAWPHIKTIFQGIA
CCCCHHHHHHHHHHH
32.3121890473
163N6-acetyllysineIFQGIAAKVGTGEPC
HHHHHHHHHCCCCCC
31.9825953088
166PhosphothreonineGIAAKVGTGEPCCDW
HHHHHHCCCCCCCCC
41.1622135298
25627689
248N6-acetyllysineKFQDTDGKHLLPKIR
HEECCCCCCCCHHHH
33.6123954790
25825284
27452117
263PhosphothreonineDSAGQKGTGKWTAIS
CCCCCCCCCCCHHHH
42.4918785766
294N6-acetyllysineARCLSSLKDERIQAS
HHHHHCCCHHHHHHH
60.5325953088
26051181
296N6-acetyllysineCLSSLKDERIQASKK
HHHCCCHHHHHHHHH
50.5319608861
309N6-acetyllysineKKLKGPQKFQFDGDK
HHCCCCCCCCCCCCH
44.2419608861
316N6-acetyllysineKFQFDGDKKSFLEDI
CCCCCCCHHHHHHHH
56.7123749302
25953088
317N6-acetyllysineFQFDGDKKSFLEDIR
CCCCCCHHHHHHHHH
51.7026822725
318PhosphoserineQFDGDKKSFLEDIRK
CCCCCHHHHHHHHHH
40.5822135298
25627689
324N6-methyllysineKSFLEDIRKALYASK
HHHHHHHHHHHHHHH
30.43115487209
375N6-acetyllysineIRSVFLGKIKDAFDR
HHHHHHHHHHHHHHC
49.0525953088
377UbiquitinlysineSVFLGKIKDAFDRNP
HHHHHHHHHHHHCCH
46.6321890473
21906983
22053931
21139048
470PhosphothreonineQFIHTNWTGHGGTVS
CEEECCCCCCCCCCC
22.7520068231
475PhosphothreonineNWTGHGGTVSSSSYN
CCCCCCCCCCCCCCC
23.0822135298
478PhosphoserineGHGGTVSSSSYNA--
CCCCCCCCCCCCC--
20.9725627689
479PhosphoserineHGGTVSSSSYNA---
CCCCCCCCCCCC---
29.3622135298
25627689
480PhosphoserineGGTVSSSSYNA----
CCCCCCCCCCC----
25.1022135298
25627689
23917254
481PhosphotyrosineGTVSSSSYNA-----
CCCCCCCCCC-----
19.6322135298

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of 6PGD_HUMAN !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions
AL7A1_HUMANALDH7A1physical
22863883
AL9A1_HUMANALDH9A1physical
22863883
EF2_HUMANEEF2physical
22863883
AGAL_HUMANGLAphysical
22863883
GNAI3_HUMANGNAI3physical
22863883
HMGB2_HUMANHMGB2physical
22863883
KS6A1_HUMANRPS6KA1physical
22863883
TXND5_HUMANTXNDC5physical
22863883
FABP5_HUMANFABP5physical
26344197
GDIA_HUMANGDI1physical
26344197
PDIA1_HUMANP4HBphysical
26344197
SUMO3_HUMANSUMO3physical
26344197
TALDO_HUMANTALDO1physical
26344197

Drug and Disease Associations
Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
DB00851Dacarbazine
DB00695Furosemide
DB00789Gadopentetate dimeglumine
DB00920Ketotifen
DB00814Meloxicam
DB00563Methotrexate
DB00867Ritodrine
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-38; LYS-59; LYS-76; LYS-154AND LYS-309, AND MASS SPECTROMETRY.

TOP