AADAT_HUMAN - dbPTM
AADAT_HUMAN - PTM Information in dbPTM
Basic Information of Protein
UniProt ID AADAT_HUMAN
UniProt AC Q8N5Z0
Protein Name Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
Gene Name AADAT
Organism Homo sapiens (Human).
Sequence Length 425
Subcellular Localization Mitochondrion .
Protein Description Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro)..
Protein Sequence MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster
31N6-acetyllysineDILSRGPKSMISLAG
HHHHHCCHHHHHHCC
56.3220167786
32PhosphoserineILSRGPKSMISLAGG
HHHHCCHHHHHHCCC
25.2050558251
35PhosphoserineRGPKSMISLAGGLPN
HCCHHHHHHCCCCCC
11.9750558259
49N6-acetyllysineNPNMFPFKTAVITVE
CCCCCCCCEEEEEEE
35.4920167786
69N6-acetyllysineQFGEEMMKRALQYSP
ECCHHHHHHHHHHCC
32.962380865
176PhosphoserineDSLRDILSRWKPEDA
HHHHHHHHHCCHHHC
36.1146156151

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of AADAT_HUMAN !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of AADAT_HUMAN !!

Drug and Disease Associations
Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.
Related Literatures of Post-Translational Modification

TOP