AAT_ECOLI - dbPTM
AAT_ECOLI - PTM Information in dbPTM
Basic Information of Protein
UniProt ID AAT_ECOLI
UniProt AC P00509
Protein Name Aspartate aminotransferase
Gene Name aspC
Organism Escherichia coli (strain K12).
Sequence Length 396
Subcellular Localization Cytoplasm.
Protein Description
Protein Sequence MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Overview of Protein Modification Sites with Functional and Structural Information