AAT_ECOLI - dbPTM
AAT_ECOLI - PTM Information in dbPTM
Basic Information of Protein
UniProt ID AAT_ECOLI
UniProt AC P00509
Protein Name Aspartate aminotransferase
Gene Name aspC
Organism Escherichia coli (strain K12).
Sequence Length 396
Subcellular Localization Cytoplasm.
Protein Description
Protein Sequence MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster
28N6-acetyllysineRADERPGKINLGIGV
HCCCCCCCEEEEEEC
30.9823830618
28N6-succinyllysineRADERPGKINLGIGV
HCCCCCCCEEEEEEC
30.9824176774
37N6-acetyllysineNLGIGVYKDETGKTP
EEEEECCCCCCCCCC
46.8323294111
23830618
24176774
25518064
37N6-succinyllysineNLGIGVYKDETGKTP
EEEEECCCCCCCCCC
46.8323954790
24176774
42N6-acetyllysineVYKDETGKTPVLTSV
CCCCCCCCCCCCCCH
58.0123830618
25518064
42N6-succinyllysineVYKDETGKTPVLTSV
CCCCCCCCCCCCCCH
58.0123954790
24176774
50N6-succinyllysineTPVLTSVKKAEQYLL
CCCCCCHHHHHHHHH
46.1423954790
24176774
51N6-acetyllysinePVLTSVKKAEQYLLE
CCCCCHHHHHHHHHH
55.8123294111
23830618
24176774
51N6-succinyllysinePVLTSVKKAEQYLLE
CCCCCHHHHHHHHHH
55.8123954790
24176774
63N6-acetyllysineLLENETTKNYLGIDG
HHHCCCCCCCCCCCC
51.5223830618
85N6-acetyllysineTQELLFGKGSALIND
HHHHHCCCCCCCCCC
42.2123830618
24176774
93N6-acetyllysineGSALINDKRARTAQT
CCCCCCCCEEEEEEE
43.3923830618
24176774
25518064
93N6-succinyllysineGSALINDKRARTAQT
CCCCCCCCEEEEEEE
43.3924176774
116N6-acetyllysineVAADFLAKNTSVKRV
HHHHHHHHHCCCCEE
64.0123830618
24176774
25518064
116N6-succinyllysineVAADFLAKNTSVKRV
HHHHHHHHHCCCCEE
64.0123954790
24176774
121N6-succinyllysineLAKNTSVKRVWVSNP
HHHHCCCCEEEEECC
40.7924176774
134N6-acetyllysineNPSWPNHKSVFNSAG
CCCCCCHHHHHHHCC
55.7623830618
24176774
134N6-succinyllysineNPSWPNHKSVFNSAG
CCCCCCHHHHHHHCC
55.7623954790
24176774
236N6-succinyllysineRAFAAMHKELIVASS
HHHHHCCCCEEEEEC
40.9223954790
24176774
276N6-acetyllysineDRAFSQMKAAIRANY
HHHHHHHHHHHHHHC
27.3323294111
23830618
24176774
25518064
276N6-succinyllysineDRAFSQMKAAIRANY
HHHHHHHHHHHHHHC
27.3323954790
24176774
332N6-acetyllysineFVNTLQEKGANRDFS
HHHHHHHCCCCCCHH
50.8123830618
24176774
332N6-succinyllysineFVNTLQEKGANRDFS
HHHHHHHCCCCCCHH
50.8124176774
355N6-acetyllysineFSFSGLTKEQVLRLR
EECCCCCHHHHHHHH
51.7123830618
25518064

Disease-associated PTM Sites based on nsSNP

* Distance = the distance between SNP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SNP Related Disease Reference

Oops, there are no SNP-PTM records of AAT_ECOLI !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions
SYE_ECOLIgltXphysical
29176613
PEPB_ECOLIpepBphysical
29176613
ACNA_ECOLIacnAphysical
29176613
SYD_ECOLIaspSphysical
29176613
DAPA_ECOLIdapAphysical
29176613
FABA_ECOLIfabAphysical
29176613
PDXJ_ECOLIpdxJphysical
29176613
RIMM_ECOLIrimMphysical
29176613

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Related Literatures of Post-Translational Modification
Pyridoxal phosphate
ReferencePubMed
"Structural studies on aspartate aminotransferase from Escherichiacoli. Covalent structure.";
Kondo K., Wakabayashi S., Kagamiyama H.;
J. Biol. Chem. 262:8648-8657(1987).
Cited for: PROTEIN SEQUENCE.

TOP