Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  HLA class I histocompatibility antigen, A-2 alpha chain  

UniProtKB / Swiss-Prot ID :  1A02_HUMAN

Gene Name (Synonyms) : 
HLA-A, HLAA  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Membrane; Single-pass type I membrane protein. 

Protein Function :  Involved in the presentation of foreign antigens to the immune system. 

Transmembrane Topology (topPTM) : 1A02_HUMAN 

Protein Sequence MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME...
Predicted Secondary Structure CCCCCCHHHHHHHHHHHHCCCCCCCCEEEEEEEEEEECCCCCCCEEEEEEEECCEEEEEEECCCCCCCEE...
Protein Variant
LocationDescription
33F -> Y (in allele A*02:05, alleleA*02:06, allele A*02:08, allele A*02:10
54D -> N (in allele A*02:21). VAR_004335
65A -> G (in allele A*02:31). VAR_016726
67Q -> R (in allele A*02:02, allele A*02:05and allele A*02:08).
90K -> N (in allele A*02:08 and alleleA*02:20).
94H -> Q (in allele A*02:34 and alleleA*02:35).
97T -> I (in allele A*02:11). VAR_004338
98H -> D (in allele A*02:11 and alleleA*02:35).
119V -> L (in allele A*02:02, alleleA*02:05, allele A*02:08 and allele
121R -> M (in allele A*02:04 and alleleA*02:17).
123Y -> C (in allele A*02:07 and alleleA*02:18).
123Y -> F (in allele A*02:10 and alleleA*02:17).
131W -> G (in allele A*02:10). VAR_004343
162M -> K (in allele A*02:18). VAR_004344
173A -> T (in allele A*02:03). VAR_004345
176V -> E (in allele A*02:03 and alleleA*02:13).
180L -> Q (in allele A*02:12, allele A*02:13and allele A*02:37).
180L -> W (in allele A*02:02, alleleA*02:03, allele A*02:05 and allele
187T -> E (in allele A*02:16; requires 2nucleotide substitutions).
190E -> D (in allele A*02:36 and alleleA*02:37).
191W -> G (in allele A*02:36 and alleleA*02:37).
260A -> E (in allele A*02:09). VAR_004350
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
110N-linked (GlcNAc...).RGYYNQSEA
HHHCCCCCC
30.34UniProtKB
Link
145Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AYDGKDYIA
EECCEEEEE
44.45Phosphositeplus
Link
151Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YIALKEDLR
EEEECCCCC
39.91Phosphositeplus
Link
168Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AQTTKHKWE
HHHHHHHHC
46.72Phosphositeplus
Link
200Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LENGKETLQ
HCCCCCCCC
60.14Phosphositeplus
Link
267Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GTFQKWAAV
CCEEEEEEE
34.31Phosphositeplus
Link
292Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EGLPKPLTL
CCCCCCEEE
58.67Phosphositeplus
Link
337PhosphoserineRRKSSDRKG
EECCCCCCC
44.46Phosphositeplus
Link-
340Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SSDRKGGSY
CCCCCCCCC
73.03Phosphositeplus
Link-
343PhosphoserineRKGGSYSQA
CCCCCCCCC
30.22Phosphositeplus
Link-
344PhosphotyrosineKGGSYSQAA
CCCCCCCCC
14.21PhosphoELM
Link-
344PhosphotyrosineKGGSYSQAA
CCCCCCCCC
14.21Phosphositeplus
Link-
345PhosphoserineGGSYSQAAS
CCCCCCCCC
18.29Phosphositeplus
Link-
349PhosphoserineSQAASSDSA
CCCCCCCCC
37.38Phosphositeplus
Link-
350PhosphoserineQAASSDSAQ
CCCCCCCCC
30.75Phosphositeplus
Link-
352PhosphoserineASSDSAQGS
CCCCCCCCC
25.17Phosphositeplus
Link-
352PhosphoserineASSDSAQGS
CCCCCCCCC
25.17SysPTM
Link-
352Phosphoserine.ASSDSAQGS
CCCCCCCCC
25.17UniProtKB
Link-
356PhosphoserineSAQGSDVSL
CCCCCEEEE
23.82Phosphositeplus
Link-
356PhosphoserineSAQGSDVSL
CCCCCEEEE
23.82SysPTM
Link-
356Phosphoserine.SAQGSDVSL
CCCCCEEEE
23.82UniProtKB
Link-
359PhosphoserineGSDVSLTAC
CCEEEECCC
25.62PhosphoELM
Link-
359PhosphoserineGSDVSLTAC
CCEEEECCC
25.62Phosphositeplus
Link-
361PhosphothreonineDVSLTACKV
EEEECCCCC
23.62Phosphositeplus
Link-
364Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LTACKV
ECCCCC
48.81Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
B2MG_HUMANphysical interactionMINT-24957MINT11502003
- top -

Disease Reference
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry.";
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
J. Proteome Res. 8:651-661(2009).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-110, AND MASSSPECTROMETRY.
Phosphorylation
ReferencePubMed
"Phosphoproteome of resting human platelets.";
Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J.,Schuetz C., Walter U., Gambaryan S., Sickmann A.;
J. Proteome Res. 7:526-534(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-352 AND SER-356, ANDMASS SPECTROMETRY.
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-352 AND SER-356, ANDMASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures