Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  1-aminocyclopropane-1-carboxylate synthase 2  

UniProtKB / Swiss-Prot ID :  1A12_SOLLC

Gene Name (Synonyms) : 
ACS2, ACC2, PCVV4A  

Species :  Solanum lycopersicum (Tomato) (Lycopersicon esculentum). 

Subcellular Localization :   

Protein Function :  1-aminocyclopropane-1-carboxylate synthase (ACS) enzymes catalyze the conversion of S-adenosyl-L-methionine (SAM) into 1- aminocyclopropane-1-carboxylate (ACC), a direct precursor of ethylene. 

Protein Sequence MGFEIAKTNSILSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLCLDLIEDWIKRN...
Predicted Secondary Structure CCCCCCCCCHHHHHHCCCCCCCCCCCEECCCHHHHCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
278N6-(pyridoxal phosphate)lysine.YSLSKDMGL
ECCHHHCCC
57.96UniProtKB
Link
460Phosphoserine.NLRLSFSKR
HHHHEECCC
22.50UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Phosphorylation of tomato 1-aminocyclopropane-1-carboxylic acidsynthase, LE-ACS2, at the C-terminal region.";
Tatsuki M., Mori H.;
J. Biol. Chem. 276:28051-28057(2001).
Cited for: PHOSPHORYLATION AT SER-460.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures