Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform  

UniProtKB / Swiss-Prot ID :  2AAB_HUMAN

Gene Name (Synonyms) : 
PPP2R1B  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  The PR65 subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. 

Protein Sequence MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDT...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCC...
Protein Variant
LocationDescription
8G -> R (in a lung cancer patient). VAR_022895
15G -> A (in a colorectal cancer patient). VAR_022896
65P -> S (in a lung cancer patient). VAR_022897
90G -> D (in a lung cancer patient;dbSNP:rs1805076).
101L -> P (in a colon adenocarcinoma). VAR_022898
343K -> E (in a lung cancer patient). VAR_022899
365S -> P (in a colorectal cancer patient). VAR_022900
448V -> A (in a colon adenocarcinoma). VAR_022901
498V -> E (in a colorectal cancer patient). VAR_022902
499L -> I (in a colorectal cancer patient). VAR_022903
500V -> G (in a colorectal cancer patient). VAR_022904
504D -> G (in a lung cancer patient). VAR_022905
545V -> A (in a colon adenocarcinoma). VAR_022906
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
48PhosphoserineIKKLSTIAL
HHHHHHHHH
27.01HPRD
Link-
49PhosphothreonineKKLSTIALA
HHHHHHHHH
22.24HPRD
Link-
59PhosphothreonineGVERTRSEL
CCCCHHHHH
25.66HPRD
Link-
119Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VVRDKAVES
HHHHHHHHH
43.71Phosphositeplus
Link-
145Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VPLVKRLAS
HHHHHHHHH
49.75Phosphositeplus
Link-
175Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SNAVKAEIR
CHHHHHHHH
37.58Phosphositeplus
Link-
200Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AAASKLGEF
HHHHHHHCC
56.64Phosphositeplus
Link-
206Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GEFAKVLEL
HCCCCCCCC
53.31Phosphositeplus
Link-
212PhosphoserineLELDSVKSE
CCCHHHHHH
44.03HPRD
Link-
212PhosphoserineLELDSVKSE
CCCHHHHHH
44.03Phosphositeplus
Link-
214Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LDSVKSEIV
CHHHHHHHH
46.45Phosphositeplus
Link-
284Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SELQKAMGP
HHHHHHCCC
53.62Phosphositeplus
Link-
304Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QNLLKDCEA
HHHHHCCCH
64.60Phosphositeplus
Link-
428Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AEDAKWRVR
HHCCCHHHH
48.10Phosphositeplus
Link-
484Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KLVQKFGTE
HHHHHHHHH
37.98Phosphositeplus
Link-
497Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TIVPKVLVM
HHHHHHHHH
36.99Phosphositeplus
Link-
554Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FNVAKSLQK
HHHHHHHHH
47.63Phosphositeplus
Link-
558Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KSLQKIGPI
HHHHHHHHH
55.73Phosphositeplus
Link-
573Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QGEVKPVLQ
HHHHHHHHH
25.71Phosphositeplus
Link-
578Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PVLQKLGQD
HHHHHHHCC
50.88Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
PP2AA_HUMANphysical interaction
physical interaction
EBI-1266031
EBI-1266363
intact17540176
17540176
STRN3_HUMANphysical interaction
physical interaction
EBI-1266474
EBI-1266363
intact17540176
17540176
CDC2_HUMANphysical interaction
physical interaction
EBI-1266474
EBI-1266363
intact17540176
17540176
CDK4_HUMANphysical interaction
physical interaction
EBI-1266474
EBI-1266363
intact17540176
17540176
2A5E_HUMANphysical interaction
physical interaction
EBI-1266222
EBI-1266363
intact17540176
17540176
2A5D_HUMANphysical interactionEBI-1266204
intact17540176
2A5G_HUMANphysical interactionEBI-1266182
intact17540176
2ABA_HUMANphysical interaction
physical interaction
EBI-1266140
EBI-1266363
intact17540176
17540176
RAB7A_HUMANphysical interactionEBI-1266363
intact17540176
PRDX1_HUMANphysical interactionEBI-1266363
intact17540176
Q5W0I9_HUMANphysical interactionEBI-1266363
intact17540176
PARK7_HUMANphysical interactionEBI-1266363
intact17540176
CH60_HUMANphysical interactionEBI-1266363
intact17540176
ANXA5_HUMANphysical interactionEBI-1266363
intact17540176
MCM3_HUMANphysical interactionEBI-1266363
intact17540176
PRDX2_HUMANphysical interactionEBI-1266363
intact17540176
EF2_HUMANphysical interactionEBI-1266363
intact17540176
RB11A_HUMANphysical interactionEBI-1266363
intact17540176
STRN_HUMANphysical interactionEBI-1266363
intact17540176
FR1OP_HUMANphysical interactionEBI-1266363
intact17540176
HDAC1_HUMANphysical interactionEBI-1266363
intact17540176
JAK2_HUMANin vivoHPRD:04384HPRD11440634
TF65_HUMANin vitro
in vivo
HPRD:04384HPRD11591705
2A5G_HUMANin vivoHPRD:04384HPRD11929880
CFTR_HUMANin vivo
yeast 2-hybrid
HPRD:04384HPRD15936019
SET_HUMANin vitroHPRD:04384HPRD9353299
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures