Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform  

UniProtKB / Swiss-Prot ID :  2ABA_HUMAN

Gene Name (Synonyms) : 
PPP2R2A  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. 

Protein Sequence MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSHSRGE...
Predicted Secondary Structure CCCCCCCCCCEEEEEEEECCCCCCCCCEEEEEEEEECCCCCEEEECCCCCEEEEEECCCCCCCCCCCCCE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAGAGG
---CCCCCC
19.28UniProtKB
Link-
62Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EQENKIQSH
CCCCCCCCC
41.17Phosphositeplus
Link-
88Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FDYLKSLEI
CCHHHCCCH
46.92Phosphositeplus
Link
88N6-acetyllysineFDYLKSLEI
CCHHHCCCH
46.92Phosphositeplus
Link
98N6-acetyllysineEKINKIRWL
HHHCEEEEC
36.80Phosphositeplus
Link
105Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)WLPQKNAAQ
ECCCCCCCE
46.76Phosphositeplus
Link
117Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)STNDKTIKL
ECCCCEEEE
54.97Phosphositeplus
Link
129Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SERDKRPEG
EECCCCCCC
75.87Phosphositeplus
Link
137Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GYNLKEEDG
CCCCCCCCC
56.25Phosphositeplus
Link-
167PhosphoserineMVEASPRRI
EECCCCEEE
12.87HPRD
Link
167PhosphoserineMVEASPRRI
EECCCCEEE
12.87Phosphositeplus
Link
378PhosphothreonineKRDITLEAS
CEEEEEECC
23.88HPRD
Link
404Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SGKRKKDEI
CCCCCCCCE
68.97Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
P53_HUMANphysical interactionMINT-4299164MINT17245430
TGFR1_HUMANin vitro
in vivo
HPRD:09223HPRD9774674
2AAB_HUMANin vitroHPRD:09223HPRD1328247
NMDE4_HUMANin vivoHPRD:09223HPRD10862698
PP2AB_HUMANENSP00000325074STRING
PP2AA_HUMANENSP00000325074STRING
PIN1_HUMANENSP00000325074STRING
PIN1_HUMANENSP00000325074STRING
RAF1_HUMANENSP00000325074STRING
2AAA_HUMANENSP00000325074STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures