Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  6-phosphogluconate dehydrogenase, decarboxylating  

UniProtKB / Swiss-Prot ID :  6PGD_HUMAN

Gene Name (Synonyms) : 
PGD, PGDH  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm (By similarity). 

Protein Function :  Catalyzes the oxidative decarboxylation of 6- phosphogluconate to ribulose 5-phosphate and CO(2), with concomitant reduction of NADP to NADPH (By similarity). 

Protein Sequence MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRR...
Predicted Secondary Structure CCCCCEEEEECCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCE...
Protein Variant
LocationDescription
268A -> S (in dbSNP:rs11547610). VAR_048104
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
38Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RTVSKVDDF
CCHHHHHHH
45.40Phosphositeplus
Link
38N6-acetyllysineRTVSKVDDF
CCHHHHHHH
45.40HPRD
Link
38N6-acetyllysineRTVSKVDDF
CCHHHHHHH
45.40Phosphositeplus
Link
38N6-acetyllysine.RTVSKVDDF
CCHHHHHHH
45.40UniProtKB
Link
48Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ANEAKGTKV
HCCCCCCCC
62.02Phosphositeplus
Link
59Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AQSLKEMVS
HHHHHHHHH
49.35Phosphositeplus
Link
59N6-acetyllysineAQSLKEMVS
HHHHHHHHH
49.35HPRD
Link
59N6-acetyllysineAQSLKEMVS
HHHHHHHHH
49.35Phosphositeplus
Link
59N6-acetyllysine.AQSLKEMVS
HHHHHHHHH
49.35UniProtKB
Link
76N6-acetyllysineILLVKAGQA
EEEECCCHH
46.93HPRD
Link
76N6-acetyllysineILLVKAGQA
EEEECCCHH
46.93Phosphositeplus
Link
76N6-acetyllysine.ILLVKAGQA
EEEECCCHH
46.93UniProtKB
Link
119Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DLKAKGILF
HHHHCCCCC
44.92Phosphositeplus
Link
154Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)WPHIKTIFQ
HHHHHHHHH
32.31Phosphositeplus
Link
154N6-acetyllysineWPHIKTIFQ
HHHHHHHHH
32.31HPRD
Link
154N6-acetyllysineWPHIKTIFQ
HHHHHHHHH
32.31Phosphositeplus
Link
154N6-acetyllysine.WPHIKTIFQ
HHHHHHHHH
32.31UniProtKB
Link
263PhosphothreonineGQKGTGKWT
CCCCCCHHH
42.49SysPTM
Link
309N6-acetyllysineKGPQKFQFD
CCCCCCCCC
44.24HPRD
Link
309N6-acetyllysineKGPQKFQFD
CCCCCCCCC
44.24Phosphositeplus
Link
309N6-acetyllysine.KGPQKFQFD
CCCCCCCCC
44.24UniProtKB
Link
377Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LGKIKDAFD
HHHHHHHHH
46.63Phosphositeplus
Link
470PhosphothreonineHTNWTGHGG
EECEECCCC
22.75HPRD
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
GLGB_HUMANphysical interactionMINT-63855MINT16169070
GLGB_HUMANphysical interactionEBI-737330
intact16169070
6PGL_HUMANENSP00000270776STRING
RPIA_HUMANENSP00000270776STRING
RPIA_HUMANENSP00000270776STRING
DUFFY_HUMANENSP00000270776STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00851Dacarbazine
DB00695Furosemide
DB00789Gadopentetate dimeglumine
DB00920Ketotifen
DB00814Meloxicam
DB00563Methotrexate
DB00867Ritodrine
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-38; LYS-59; LYS-76; LYS-154AND LYS-309, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures