Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial  

UniProtKB / Swiss-Prot ID :  AADAT_HUMAN

Gene Name (Synonyms) : 
AADAT, KAT2  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Mitochondrion (Potential). 

Protein Function :  Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino- group acceptors, with a preference for 2-oxoglutarate, 2- oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro). 

Protein Sequence MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKR...
Predicted Secondary Structure CCHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCEECCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHHHHH...
Protein Variant
LocationDescription
243V -> I (in dbSNP:rs56350236). VAR_061005
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
31N6-acetyllysineSRGPKSMIS
HCCCCCCEE
56.32Phosphositeplus
Link
49N6-acetyllysineMFPFKTAVI
CCCHHHHHH
35.49Phosphositeplus
Link
263N6-(pyridoxal phosphate)lysine.DSFSKIISS
ECCHHHHCC
41.89UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
KYNU_HUMANENSP00000226840STRING
RDH12_HUMANENSP00000226840STRING
DHB12_HUMANENSP00000226840STRING
ADPPT_HUMANENSP00000226840STRING
RDH13_HUMANENSP00000226840STRING
3BHS7_HUMANENSP00000226840STRING
AFMID_HUMANENSP00000226840STRING
AK1BA_HUMANENSP00000226840STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures