Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Aspartate aminotransferase, cytoplasmic  

UniProtKB / Swiss-Prot ID :  AATC_CHICK

Gene Name (Synonyms) : 
GOT1  

Species :  Gallus gallus (Chicken). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Plays a key role in amino acid metabolism. 

Protein Sequence MAASIFAAVPRAPPVAVFKLTADFREDGDSRKVNLGVGAYRTDEGQPWVLPVVRKVEQLIAGDGSLNHEY...
Predicted Secondary Structure CCCCHHHCCCCCCCCHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAASIF
---CCCCHH
15.20UniProtKB
Link
258N6-(pyridoxal phosphate)lysine.QSFSKNFGL
ECCHHHHHH
55.04UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Primary structure of cytoplasmic aspartate aminotransferase fromchicken heart and its homology with pig heart isoenzymes.";
Shlyapnikov S.V., Myasnikov A.N., Severin E.S., Myagkova M.A.,Torchinsky Y.M., Braunstein A.E.;
FEBS Lett. 106:385-388(1979).
Cited for: PROTEIN SEQUENCE OF 2-412.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures