Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Aspartate aminotransferase, cytoplasmic  

UniProtKB / Swiss-Prot ID :  AATC_HUMAN

Gene Name (Synonyms) : 
GOT1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Plays a key role in amino acid metabolism (By similarity). 

Protein Sequence MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLNHE...
Predicted Secondary Structure CCCHHHHHCCCCCCCCHHHHHHHHHHCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCC...
Protein Variant
LocationDescription
389Missing (results in markedly diminishedenzymatic activity).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
33Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PDPRKVNLG
CCCCCEEEC
40.64Phosphositeplus
Link
46S-nitrosocysteineRTDDCHPWV
CCCCCCCCC
4.64dbSNO
Link
56Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PVVKKVEQK
HHHHHHHHH
39.12Phosphositeplus
Link
71PhosphotyrosineLNHEYLPIL
CCCCCCCCC
15.38HPRD
Link
71PhosphotyrosineLNHEYLPIL
CCCCCCCCC
15.38PhosphoELM
Link
71PhosphotyrosineLNHEYLPIL
CCCCCCCCC
15.38Phosphositeplus
Link
71Phosphotyrosine.LNHEYLPIL
CCCCCCCCC
15.38UniProtKB
Link
97Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SPALKEKRV
CCCCCCCCE
64.39Phosphositeplus
Link
99Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ALKEKRVGG
CCCCCCEEE
51.28Phosphositeplus
Link
154N6-acetyllysineAAGFKDIRS
HHCCEEEEE
51.86Phosphositeplus
Link
166Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)WDAEKRGLD
CCCCCCCCC
54.19Phosphositeplus
Link
226PhosphotyrosineFDSAYQGFA
EEHHHHHCC
17.08Phosphositeplus
Link
264PhosphotyrosineNFGLYNERV
HHHHHHHHH
18.50Phosphositeplus
Link
325Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TGNVKTMAD
HHHHHHHHH
36.26Phosphositeplus
Link
333PhosphothreonineDRILTMRSE
HHHHHHHHH
14.25HPRD
Link
333PhosphothreonineDRILTMRSE
HHHHHHHHH
14.25Phosphositeplus
Link
378Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LVNEKHIYL
HHHHCCEEE
30.05Phosphositeplus
Link
396Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GLTTKNLDY
CCCCCHHHH
50.72Phosphositeplus
Link
411Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EAVTKIQ
HHHHHCC
32.29Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
T120A_HUMANphysical interactionMINT-64803MINT16169070
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00128L-Aspartic Acid
DB00151L-Cysteine
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer.";
Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.;
Cell 131:1190-1203(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-71, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures