Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Aspartate aminotransferase  

UniProtKB / Swiss-Prot ID :  AAT_ECOLI

Gene Name (Synonyms) : 
aspC b0928, JW0911  

Species :  Escherichia coli (strain K12). 

Subcellular Localization :  Cytoplasm. 

Protein Function :   

Protein Sequence MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDG...
Predicted Secondary Structure CCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
246N6-(pyridoxal phosphate)lysine.SSYSKNFGL
ECCHHHHHH
48.33UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Pyridoxal phosphate
ReferencePubMed
"Structural studies on aspartate aminotransferase from Escherichiacoli. Covalent structure.";
Kondo K., Wakabayashi S., Kagamiyama H.;
J. Biol. Chem. 262:8648-8657(1987).
Cited for: PROTEIN SEQUENCE.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures