Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Acyl-CoA-binding protein  

UniProtKB / Swiss-Prot ID :  ACBP_BOVIN

Gene Name (Synonyms) : 
DBI  

Species :  Bos taurus (Bovine). 

Subcellular Localization :   

Protein Function :  Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor. 

Protein Sequence MSQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDA...
Predicted Secondary Structure CCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylserine.---MSQAEF
---CCHHHH
37.79UniProtKB
Link
19N6-acetyllysineHLKTKPADE
CCCCCCCHH
36.30Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Complete amino acid sequences of bovine and human endozepines.Homology with rat diazepam binding inhibitor.";
Marquardt H., Todaro G.J., Shoyab M.;
J. Biol. Chem. 261:9727-9731(1986).
Cited for: PROTEIN SEQUENCE OF 2-87, AND ACETYLATION AT SER-2.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures