Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Acetylcholinesterase  

UniProtKB / Swiss-Prot ID :  ACES_HUMAN

Gene Name (Synonyms) : 
ACHE  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cell junction, synapse. Secreted (By similarity). Cell membrane; Peripheral membrane protein (By similarity). Isoform T: Nucleus. Note=Only observed in apoptotic nuclei. Isoform H: Cell membrane; Lipid-anchor, GPI- anchor; Extracellular side (By similari 

Protein Function :  Terminates signal transduction at the neuromuscular junction by rapid hydrolysis of the acetylcholine released into the synaptic cleft. Role in neuronal apoptosis. 

Protein Sequence MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAE...
Predicted Secondary Structure CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCEEEEEEECCCCCCEEEEECCCCCC...
Protein Variant
LocationDescription
34R -> Q (in dbSNP:rs17881553). VAR_021325
135P -> A (in dbSNP:rs17885778). VAR_021326
333V -> E (in dbSNP:rs8286). VAR_011934
353H -> N (in Yt(b) antigen;dbSNP:rs1799805).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
164PhosphotyrosineSLDVYDGRF
CCCCCCCEE
16.61HPRD
Link
164PhosphotyrosineSLDVYDGRF
CCCCCCCEE
16.61PhosphoELM
Link
164PhosphotyrosineSLDVYDGRF
CCCCCCCEE
16.61Phosphositeplus
Link
296N-linked (Glc...)GTGGNDTEL
CCCCCHHHH
55.14HPRD
Link
381N-linked (Glc...)FSKDNESLI
CCCCCCCCC
44.48HPRD
Link
381N-linked (GlcNAc...).FSKDNESLI
CCCCCCCCC
44.48UniProtKB
Link
495N-linked (Glc...)DPSRNYTAE
CCCCCCCHH
42.73HPRD
Link
495N-linked (GlcNAc...).DPSRNYTAE
CCCCCCCHH
42.73UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
ACES_HUMANin vivoHPRD:00010HPRD7085778
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
Kegg drug
D00043 Isoflurophate (USP); Fluostigmine; Floropryl (TN)
D00196 Physostigmine (USP); Eserine (TN)
D00469 Pralidoxime chloride (USP); Pralidoxime (INN); Protopam (TN)
D00487 Pyridostigmine bromide (JP16/USP/INN); Mestinon (TN)
D00667 Demecarium bromide (USP/INN); Humorsol (TN)
D00670 Donepezil hydrochloride (JP16/USAN); Aricept (TN)
D00994 Edrophonium chloride (JP16/USP/INN); Enlon (TN); Tensilon (TN)
D00995 Neostigmine bromide (JAN/USP/INN); Vagostigmin (TN)
D00998 Neostigmine methylsulfate (JP16/USP); Bloxiverz (TN); Prostigmin (TN)
D00999 Acetylcholine chloride (JP16/USP/INN); Miochol (TN)
D01001 Ambenonium chloride (JP16/INN); Mytelase (TN)
D01228 Distigmine bromide (JP16/INN); Ubretid (TN)
D01572 Pralidoxime iodide (JAN/USAN); Pam (TN)
D02068 Tacrine hydrochloride (USP); Cognex (TN)
D02173 Galantamine hydrobromide (JAN/USAN); Razadyne (TN); Reminyl (TN)
D02193 Ecothiopate iodide (JP16/INN); Echothiophate iodide (USP); Phospholine iodide (TN)
D02418 Physostigmine salicylate (JAN/USP); Antilirium (TN)
D02558 Rivastigmine tartrate; Exelon (TN)
D02565 Dimetacrine (INN)
D02729 Itopride hydrochloride (JAN); Ganaton (TN)
D03099 Besipirdine hydrochloride (USAN)
D03239 Ladostigil tartrate (USAN)
D03378 Caracemide (USAN)
D03751 Icopezil maleate (USAN)
D03822 Rivastigmine (JAN/USAN/INN); Exelon (TN)
D03826 Physostigmine sulfate (USP); Eserine sulfate (TN)
D04292 Galantamine (USAN/INN); Reminyl (TN)
D05215 Obidoxime chloride (USAN)
D05590 Pralidoxime mesylate (USAN)
D06288 Velnacrine maleate (USAN); Mentane (TN)
D07869 Donepezil (INN); Donaz (TN)
D08094 Itopride (INN)
D08261 Neostigmine (BAN); Prostigmin (TN)
D08555 Tacrine (INN); Tacrinal (TN)
D08838 Acotiamide hydrochloride hydrate (JAN); Acotiamide hydrochloride (USAN)
D09750 Ipidacrine hydrochloride hydrate (JAN)
D09835 Zanapezil fumarate (JAN)
D09917 Latrepirdine (USAN/INN)
D09918 Latrepirdine dihydrochloride (USAN); Dimebolin; Dimebon
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"Structures of recombinant native and E202Q mutant humanacetylcholinesterase complexed with the snake-venom toxin fasciculin-II.";
Kryger G., Harel M., Giles K., Toker L., Velan B., Lazar A.,Kronman C., Barak D., Ariel N., Shafferman A., Silman I.,Sussman J.L.;
Acta Crystallogr. D 56:1385-1394(2000).
Cited for: X-RAY CRYSTALLOGRAPHY (2.9 ANGSTROMS) OF 32-614 IN COMPLEX WITHFASCICULIN-2, AND GLYCOSYLATION AT ASN-381 AND ASN-495.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures