Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Acetylcholinesterase  

UniProtKB / Swiss-Prot ID :  ACES_MOUSE

Gene Name (Synonyms) : 
Ache  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cell junction, synapse. Secreted. Cell membrane; Peripheral membrane protein (By similarity). Isoform H: Cell membrane; Lipid-anchor, GPI- anchor; Extracellular side. 

Protein Function :  Terminates signal transduction at the neuromuscular junction by rapid hydrolysis of the acetylcholine released into the synaptic cleft. 

Protein Sequence MRPPWYPLHTPSLAFPLLFLLLSLLGGGARAEGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAE...
Predicted Secondary Structure CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCEEEEEEECCCCCEEEEEECCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
381N-linked (GlcNAc...).FSKDNESLI
CCCCCCCCC
44.48UniProtKB
Link
495N-linked (GlcNAc...).DPSLNYTTE
CCCCCCCHH
36.12UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures