Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Acetylcholinesterase  

UniProtKB / Swiss-Prot ID :  ACES_TORMA

Gene Name (Synonyms) : 
ache  

Species :  Torpedo marmorata (Marbled electric ray). 

Subcellular Localization :  Isoform H: Cell membrane; Lipid-anchor, GPI- anchor. Cell junction, synapse. Isoform T: Cell membrane; Peripheral membrane protein. Cell junction, synapse. Note=Attached to the membrane through disulfide linkage with the collagenic subunit, itself bound  

Protein Function :  Terminates signal transduction at the neuromuscular junction by rapid hydrolysis of the acetylcholine released into the synaptic cleft. May be involved in cell-cell interactions. 

Protein Sequence MREMNLLVTSSLGVLLHLVVLCQADDDSELLVNTKSGKVMRTRIPVLSSHISAFLGIPFAEPPVGNMRFR...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEECCCCEEECEEEECCCCCEEEEECCCCCCCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
567GPI-anchor amidated serine.GELSSSGTS
CCCCCCCCC
45.47UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures