Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Actinorhodin polyketide synthase acyl carrier protein  

UniProtKB / Swiss-Prot ID :  ACPX_STRCO

Gene Name (Synonyms) : 
SCO5089 SCBAC28G1.15  

Species :  Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145). 

Subcellular Localization :   

Protein Function :  Acyl carrier protein. 

Protein Sequence MATLLTTDDLRRALVECAGETDGTDLSGDFLDLRFEDIGYDSLALMETAARLESRYGVSIPDDVAGRVDT...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHCCCCCCCCCCHHHHCCHHHHCHHHHHHHHHHHHHHHHHCCCCCCCHHHCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
42O-(pantetheine 4'-phosphoryl)serine.IGYDSLALM
HCHHHHHHH
13.68UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphopantetheine
ReferencePubMed
"Solution structure of the actinorhodin polyketide synthase acylcarrier protein from Streptomyces coelicolor A3(2).";
Crump M.P., Crosby J., Dempsey C.E., Parkinson J.A., Murray M.,Hopwood D.A., Simpson T.J.;
Biochemistry 36:6000-6008(1997).
Cited for: STRUCTURE BY NMR.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures