Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  NADP-dependent alcohol dehydrogenase 6  

UniProtKB / Swiss-Prot ID :  ADH6_YEAST

Gene Name (Synonyms) : 
ADH6 YMR318C YM9924.10C  

Species :  Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). 

Subcellular Localization :   

Protein Function :  NADP-dependent alcohol dehydrogenase with a broad substrate specificity. 

Protein Sequence MSYPEKFEGIAIQSHEDWKNPKKTKYDPKPFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEI...
Predicted Secondary Structure CCCCCCEEEEEEEECCCCCCCEEEEEEECCCCCCEEEEEEEEEECCHHHHHEEECCCCCCCCCEEECCCE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
122PhosphoserineVTTYSQPYE
CCCCCCCCC
23.68SysPTM
Link
122Phosphoserine.VTTYSQPYE
CCCCCCCCC
23.68UniProtKB
Link
131PhosphoserineDGYVSQGGY
CCCCCCCCC
18.02SysPTM
Link
131Phosphoserine.DGYVSQGGY
CCCCCCCCC
18.02UniProtKB
Link
210PhosphoserineTYVISRSSR
EEEEECCHH
18.96SysPTM
Link
210Phosphoserine.TYVISRSSR
EEEEECCHH
18.96UniProtKB
Link
359PhosphoserineDKEFSD
CCCCCC
43.43SysPTM
Link
359Phosphoserine.DKEFSD
CCCCCC
43.43UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Quantitative phosphoproteomics applied to the yeast pheromonesignaling pathway.";
Gruhler A., Olsen J.V., Mohammed S., Mortensen P., Faergeman N.J.,Mann M., Jensen O.N.;
Mol. Cell. Proteomics 4:310-327(2005).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-359, AND MASSSPECTROMETRY.
"A multidimensional chromatography technology for in-depthphosphoproteome analysis.";
Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.;
Mol. Cell. Proteomics 7:1389-1396(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-122; SER-131; SER-210AND SER-359, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures