Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Alcohol dehydrogenase class-3  

UniProtKB / Swiss-Prot ID :  ADHX_PEA

Gene Name (Synonyms) :  -
 

Species :  Pisum sativum (Garden pea). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Class-III ADH is remarkably ineffective in oxidizing ethanol, but it readily catalyzes the oxidation of long-chain primary alcohols and the oxidation of S-(hydroxymethyl) glutathione. 

Protein Sequence ATQGQVITCKAAVAWEPNKPLTIEDVEVAPPQANEVRIQILFTALCHTDAYTLGGKDPEGLFPCILGHEA...
Predicted Secondary Structure CCCCCEEEEEEEEEECCCCEEEEEEEECCCCCCCEEEEEEEEECCCHHHHHHEECCCCCCCCCEEECCCE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
1N-acetylalanine.----ATQGQ
----CCCCC
21.67UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Pea formaldehyde-active class III alcohol dehydrogenase: commonderivation of the plant and animal forms but not of the correspondingethanol-active forms (classes I and P).";
Shafqat J., El-Ahmad M., Danielsson O., Martinez M.C., Persson B.,Pares X., Joernvall H.;
Proc. Natl. Acad. Sci. U.S.A. 93:5595-5599(1996).
Cited for: PROTEIN SEQUENCE, AND ACETYLATION AT ALA-1.
"Multiplicity of N-terminal structures of medium-chain alcoholdehydrogenases. Mass-spectrometric analysis of plant, lower vertebrateand higher vertebrate class I, II, and III forms of the enzyme.";
Hjelmqvist L., Hackett M., Shafqat J., Danielsson O., Iida J.,Hendrickson R.C., Michel H., Shabanowitz J., Hunt D.F., Joernvall H.;
FEBS Lett. 367:237-240(1995).
Cited for: PARTIAL PROTEIN SEQUENCE, AND ACETYLATION AT ALA-1.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures