Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Beta-2 adrenergic receptor  

UniProtKB / Swiss-Prot ID :  ADRB2_HUMAN

Gene Name (Synonyms) : 
ADRB2, ADRB2R, B2AR  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cell membrane; Multi-pass membrane protein. Note=Colocalizes with VHL at the cell membrane. 

Protein Function :  Beta-adrenergic receptors mediate the catecholamine- induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine. 

Transmembrane Topology (topPTM) : ADRB2_HUMAN 

Protein Sequence MGQPGNGSAFLLAPNGSHAPDHDVTQERDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNY...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHH...
Protein Variant
LocationDescription
15N -> S (in dbSNP:rs33973603). VAR_049373
16G -> R (common polymorphism;dbSNP:rs1042713).
27E -> Q (in dbSNP:rs1042714). VAR_003453
34V -> M. VAR_003454
159I -> F. VAR_009125
159I -> L. VAR_009124
164T -> I (in dbSNP:rs1800888). VAR_003455
220S -> C (in dbSNP:rs3729943). VAR_025101
375K -> R. VAR_009394
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
68PhosphothreonineLQTVTNYFI
CCCHHHHHH
27.82Phosphositeplus
Link-
132PhosphotyrosineAVDRYFAIT
HHHHHHHHH
7.90Phosphositeplus
Link-
132Phosphotyrosine (IGF1R)AVDRYFAIT
HHHHHHHHH
7.90PhosphoELM
Link-
132Phosphotyrosine (INSR)AVDRYFAIT
HHHHHHHHH
7.90HPRD
Link-
141PhosphotyrosineSPFKYQSLL
HHHHHCCCC
12.06Phosphositeplus
Link-
141Phosphotyrosine (IGF1R)SPFKYQSLL
HHHHHCCCC
12.06PhosphoELM
Link-
141Phosphotyrosine (INSR)SPFKYQSLL
HHHHHCCCC
12.06HPRD
Link-
141Phosphotyrosine.SPFKYQSLL
HHHHHCCCC
12.06UniProtKB
Link-
219PhosphotyrosineMVFVYSRVF
HHHHHHHHH
4.55Phosphositeplus
Link-
246PhosphoserineVQNLSQVEQ
HHHHHHHHH
39.46HPRD
Link-
246PhosphoserineVQNLSQVEQ
HHHHHHHHH
39.46PhosphoELM
Link-
246PhosphoserineVQNLSQVEQ
HHHHHHHHH
39.46Phosphositeplus
Link-
246Phosphoserine.VQNLSQVEQ
HHHHHHHHH
39.46UniProtKB
Link-
261PhosphoserineGLRRSSKFC
HHHHHHHHH
31.29Phosphositeplus
Link-
261Phosphoserine (PRKCD)GLRRSSKFC
HHHHHHHHH
31.29HPRD
Link-
262PhosphoserineLRRSSKFCL
HHHHHHHHH
28.12Phosphositeplus
Link-
262Phosphoserine (PKA_group)LRRSSKFCL
HHHHHHHHH
28.12PhosphoELM
Link-
262Phosphoserine (PRKCD)LRRSSKFCL
HHHHHHHHH
28.12HPRD
Link-
326PhosphotyrosineNPLIYCRSP
HHHHHHHCH
6.90HPRD
Link-
326PhosphotyrosineNPLIYCRSP
HHHHHHHCH
6.90PhosphoELM
Link-
326PhosphotyrosineNPLIYCRSP
HHHHHHHCH
6.90Phosphositeplus
Link-
341N-palmitoyl cysteineQELLCLRRS
HHHHHCCCC
4.31HPRD
Link-
341S-palmitoyl cysteine.QELLCLRRS
HHHHHCCCC
4.31UniProtKB
Link-
345PhosphoserineCLRRSSLKA
HCCCCCCCC
33.32Phosphositeplus
Link-
345Phosphoserine (PKA_group)CLRRSSLKA
HCCCCCCCC
33.32PhosphoELM
Link-
345Phosphoserine (PRKCD)CLRRSSLKA
HCCCCCCCC
33.32HPRD
Link-
345Phosphoserine; by PKA.CLRRSSLKA
HCCCCCCCC
33.32UniProtKB
Link-
346PhosphoserineLRRSSLKAY
CCCCCCCCC
31.88Phosphositeplus
Link-
346Phosphoserine (PKA_group;PKB_group)LRRSSLKAY
CCCCCCCCC
31.88PhosphoELM
Link-
346Phosphoserine (PRKCD)LRRSSLKAY
CCCCCCCCC
31.88HPRD
Link-
346Phosphoserine; by PKA.LRRSSLKAY
CCCCCCCCC
31.88UniProtKB
Link-
350PhosphotyrosineSLKAYGNGY
CCCCCCCCC
14.99Phosphositeplus
Link-
350Phosphotyrosine (INSR)SLKAYGNGY
CCCCCCCCC
14.99HPRD
Link-
354PhosphotyrosineYGNGYSSNG
CCCCCCCCC
16.96Phosphositeplus
Link-
354Phosphotyrosine (INSR)YGNGYSSNG
CCCCCCCCC
16.96HPRD
Link-
355PhosphoserineGNGYSSNGN
CCCCCCCCC
20.80Phosphositeplus
Link-
355Phosphoserine (GRK_group)GNGYSSNGN
CCCCCCCCC
20.80PhosphoELM
Link-
356PhosphoserineNGYSSNGNT
CCCCCCCCC
40.03Phosphositeplus
Link-
356Phosphoserine (GRK_group)NGYSSNGNT
CCCCCCCCC
40.03PhosphoELM
Link-
360PhosphothreonineSNGNTGEQS
CCCCCCCCC
43.42Phosphositeplus
Link-
364PhosphoserineTGEQSGYHV
CCCCCCCCC
36.70HPRD
Link-
364PhosphoserineTGEQSGYHV
CCCCCCCCC
36.70Phosphositeplus
Link-
3824-hydroxyproline.CEDLPGTED
CCCCCCCCC
61.04UniProtKB
Link-
384PhosphothreonineDLPGTEDFV
CCCCCCCCC
30.37Phosphositeplus
Link-
384Phosphothreonine (GRK-2;GRK-5)DLPGTEDFV
CCCCCCCCC
30.37PhosphoELM
Link-
384Phosphothreonine (GRK5)DLPGTEDFV
CCCCCCCCC
30.37HPRD
Link-
393PhosphothreonineGHQGTVPSD
CCCCCCCCC
23.75Phosphositeplus
Link-
393Phosphothreonine (GRK-5)GHQGTVPSD
CCCCCCCCC
23.75PhosphoELM
Link-
393Phosphothreonine (GRK5)GHQGTVPSD
CCCCCCCCC
23.75HPRD
Link-
3954-hydroxyproline.QGTVPSDNI
CCCCCCCCC
35.48UniProtKB
Link-
396PhosphoserineGTVPSDNID
CCCCCCCCC
38.66Phosphositeplus
Link-
396Phosphoserine (GRK-2;GRK-5)GTVPSDNID
CCCCCCCCC
38.66PhosphoELM
Link-
396Phosphoserine (GRK5)GTVPSDNID
CCCCCCCCC
38.66HPRD
Link-
401PhosphoserineDNIDSQGRN
CCCCCCCCC
30.64Phosphositeplus
Link-
401Phosphoserine (GRK-2;GRK-5)DNIDSQGRN
CCCCCCCCC
30.64PhosphoELM
Link-
401Phosphoserine (GRK5)DNIDSQGRN
CCCCCCCCC
30.64HPRD
Link-
407PhosphoserineGRNCSTNDS
CCCCCCCCC
33.52Phosphositeplus
Link-
407Phosphoserine (GRK-2;GRK-5)GRNCSTNDS
CCCCCCCCC
33.52PhosphoELM
Link-
407Phosphoserine (GRK5)GRNCSTNDS
CCCCCCCCC
33.52HPRD
Link-
408PhosphothreonineRNCSTNDSL
CCCCCCCCC
45.29Phosphositeplus
Link
411PhosphoserineSTNDSLL
CCCCCCC
33.37Phosphositeplus
Link
411Phosphoserine (GRK-5)STNDSLL
CCCCCCC
33.37PhosphoELM
Link
411Phosphoserine (GRK5)STNDSLL
CCCCCCC
33.37HPRD
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
NHERF_HUMANdirect interactionMINT-2843018MINT9671706
SRC_HUMANphosphorylation reactionMINT-4051815MINT17170700
KPCA_HUMANphosphorylation reactionMINT-17490MINT11238007
5HT4R_HUMANphysical interactionMINT-60083MINT15896782
EI2BA_HUMANcolocalization
physical interaction
EBI-491241
EBI-491197
intact9235896
9235896
CNBP_HUMANphysical interactionEBI-1083670
intact17353931
Q7Z362_HUMANphysical interactionEBI-1078820
intact17353931
GRB2_HUMANin vitro
in vivo
HPRD:00187HPRD9830057
IL1B_HUMANin vitroHPRD:00187HPRD11238007
ARRB1_HUMANin vivoHPRD:00187HPRD16407241
NHERF_HUMANENSP00000305372STRING
- top -

Disease Reference
Kegg disease
H00079 Asthma
There are no disease associations of PTM sites.
Drug Reference
Kegg drug
D00076 Noradrenaline (JP16); Norepinephrine (INN); Nor adrenalin (TN)
D00095 Adrenaline (JP16); Epinephrine (USP/INN); Adrenalin (TN); Auvi-q (TN); Epipen (TN)
D00124 Ephedrine (USP); Ephedrine (TN)
D00255 Carvedilol (JAN/USAN/INN); Artist (TN); Coreg (TN)
D00378 Timolol (USAN); Timolol hemihydrate; Betimol (TN)
D00432 Nadolol (JP16/USP/INN); Corgard (TN)
D00483 Propranolol hydrochloride (JP16/USP); Inderal (TN); Innopran XL (TN)
D00485 Pseudoephedrine hydrochloride (USP); Sudafed (TN)
D00513 Pindolol (JP16/USP/INN); Blocklin-L (TN); Carvisken (TN); Visken (TN)
D00599 Carteolol hydrochloride (JP16/USP); Cartrol (TN); Ocupress (TN)
D00600 Labetalol hydrochloride (JP16/USP); Normodyne (TN); Trandate (TN)
D00602 Penbutolol sulfate (JP16/USP); Levatol (TN)
D00603 Timolol maleate (JP16/USP); Blocadren (TN); Istalol (TN); Timoptic (TN)
D00683 Salbutamol sulfate (JP16); Albuterol sulfate (USP); Accuneb (TN); Proventil (TN); Ventolin (TN)
D00684 Bitolterol mesilate (JAN); Bitolterol mesylate (USAN); Tornalate (TN)
D00685 Orciprenaline sulfate (JP16); Metaproterenol sulfate (USP); Alupent (TN)
D00686 Pirbuterol acetate (USAN); Maxair (TN)
D00687 Salmeterol xinafoate (JAN/USAN); Serevent (TN)
D00688 Terbutaline sulfate (JP16/USP); Brethine (TN)
D00996 Epinephrine hydrochloride (JAN); Adrenalin chloride (TN)
D01017 Dipivefrin hydrochloride (JAN/USP); Propine (TN)
D01025 Levobunolol hydrochloride (JAN/USP); Betagan (TN)
D01026 Sotalol hydrochloride (JAN/USP); Betapace (TN); Sorine (TN)
D01182 Alprenolol hydrochloride (JP16/USAN); Regletin (TN)
D01263 Ritodrine hydrochloride (JP16/USP); Yutopar (TN)
D01349 Pirbuterol hydrochloride (JAN/USAN)
D01360 Clenbuterol hydrochloride (JAN/USP); Spiropent (TN)
D01362 Tulobuterol hydrochloride (JP16); Hokunalin (TN); Respacal (TN)
D01373 Formoterol fumarate (USAN); Foradil (TN)
D01386 Ephedrine hydrochloride (JP16/USP); Ephedrine hydrochloride (TN)
D01390 dl-Isoprenaline hydrochloride (JAN); Isoproterenol hydrochloride (USP); Isuprel (TN); Proternol-S (T
D01428 Fenoterol hydrobromide (JAN); Berotec (TN)
D01444 Bunitrolol hydrochloride (JAN); Betrilol (TN)
D01454 Bupranolol hydrochloride (JP16)
D01469 Amosulalol hydrochloride (JP16); Lowgan (TN)
D01504 Bufetolol hydrochloride (JP16); Adobiol (TN)
D01512 Befunolol hydrochloride (JAN); Bentos (TN)
D01543 Nylidrin hydrochloride (JAN); Buphenine hydrochloride; Arlidin (TN)
D01589 Mabuterol hydrochloride (JAN); Broncholin (TN)
D01635 Methoxyphenamine hydrochloride (JAN); Phenamine (TN)
D01691 Nipradilol (JAN/INN); Hypadil (TN)
D01748 Isoxsuprine hydrochloride (JP16/USP); Duvadilan (TN)
D01794 Bopindolol malonate (JAN); Sandonorm (TN)
D01795 Tilisolol hydrochloride (JAN); Selecal (TN)
D01806 Oxprenolol hydrochloride (JP16/USP); Okuspurecol (TN)
D01830 Arotinolol hydrochloride (JP16); Almarl (TN)
D01835 Clorprenaline hydrochloride (JAN/USAN)
D01952 L-Methylephedrine hydrochloride (JAN)
D01958 Indenolol hydrochloride (JP16)
D01978 Trimetoquinol hydrochloride; Tretoquinol; Inolin (TN)
D02066 Isoprenaline sulfate (JAN); Isoproterenol sulfate (USP); Luf-Iso (TN); Medihaler-Iso (TN)
D02081 Metipranolol hydrochloride; Optipranolol (TN)
D02093 Isoetharine hydrochloride (USP); BETA-2 (TN)
D02109 dl-Methylephedrine hydrochloride (JP16); Methy-F (TN)
D02147 Albuterol (USP); Salbutamol; Proventil (TN)
D02149 Epinephrine bitartrate (JAN/USP); Asmatane mist (TN); Medihaler-epi (TN)
D02150 l-Isoprenaline hydrochloride (JP16); Proternol-L (TN)
D02151 Tulobuterol (JAN/INN); Atenos (TN); Hokunalin (TN)
D02281 Levalbuterol hydrochloride (USAN); Xopenex (TN)
D02349 Dipivefrin (USAN); Dipivefrine (INN)
D02359 Ritodrine (USAN/INN)
D02374 Metipranolol (USAN/INN)
D02389 Primidolol (USAN/INN)
D02396 Hexoprenaline sulfate (USAN); Delaprem (TN)
D02404 Procaterol hydrochloride (USAN); Pro-Air (TN)
D02702 Talibegron hydrochloride (USAN)
D02765 Adaprolol maleate (USAN)
D02834 Alprenoxime hydrochloride (USAN)
D02976 Arbutamine hydrochloride (USAN); Genesa (TN)
D02981 Arformoterol tartrate (USAN); Brovana (TN)
D03170 Bucindolol hydrochloride (USAN)
D03177 Bunolol hydrochloride (USAN)
D03198 Butoxamine hydrochloride (USAN)
D03402 Carbuterol hydrochloride (USAN)
D03415 Carvedilol phosphate hydrate (JAN); Carvedilol phosphate (USAN); Coreg CR (TN)
D03449 Cetamolol hydrochloride (USAN)
D03490 Cicloprolol hydrochloride (USAN)
D03502 Cimaterol (USAN/INN)
D03587 Colterol mesylate (USAN)
D03729 Dexpropranolol hydrochloride (USAN)
D03759 Diacetolol hydrochloride (USAN)
D03891 Dopexamine (USAN/INN)
D04018 Ephedrine sulfate (USP); Isofedrol (TN)
D04157 Fenoterol (USAN/INN)
D04190 Flestolol sulfate (USAN)
D04625 Isoetharine (USP); Isoetarine (INN)
D04626 Isoetharine mesylate (USP); Bronkometer (TN)
D04701 Levalbuterol sulfate (USAN)
D04703 Levalbuterol tartrate (USAN); Xopenex HFA (TN)
D04888 Medroxalol (USAN/INN)
D04889 Medroxalol hydrochloride (USAN)
D04954 Metaproterenol polistirex (USAN)
D05037 Trimetoquinol hydrochloride hydrate (JP16); Tretoquinol hydrate; Caluyon (TN)
D05206 Norepinephrine bitartrate (USP); Levophed (TN)
D05277 Formoterol fumarate hydrate (JP16); Formoterol fumarate dihydrate; Atock (TN); Foradil (TN)
D05345 Pamatolol sulfate (USAN)
D05366 Procaterol hydrochloride hydrate (JP16); Meptin (TN)
D05476 Picumeterol fumarate (USAN)
D05648 Pseudoephedrine polistirex (USAN); Pseudo-12 (TN)
D05649 Pseudoephedrine sulfate (USP); Afrinol (TN)
D05691 Ractopamine hydrochloride (USAN)
D05718 Reproterol hydrochloride (USAN)
D05730 Rimiterol hydrobromide (USAN)
D05792 Salmeterol (USAN/INN)
D05832 Sibenadet hydrochloride (USAN); Viozan (TN)
D05902 Soterenol hydrochloride (USAN)
D06374 Zinterol hydrochloride (USAN)
D07156 Alprenolol (INN)
D07181 Mepindolol (INN)
D07182 Tertatolol (INN)
D07183 Cloranolol (INN)
D07377 Bambuterol (INN)
D07451 Amosulalol (INN)
D07463 Arformoterol (INN)
D07465 Arotinolol (INN)
D07489 Bambuterol hydrochloride; Bambec (TN)
D07534 Bitolterol (INN)
D07537 Bopindolol (INN); Sandonorm (TN)
D07551 Buphenine (INN)
D07590 Bupranolol (INN)
D07608 Carazolol (INN); Conducton (TN); Suacron [veterinary] (TN)
D07624 Carteolol (INN)
D07713 Clenbuterol (INN); Contraspasmin (TN); Planipart [veterinary] (TN)
D07990 Formoterol (INN); Oxis (TN)
D08039 Hexoprenaline (INN); Ipradol (TN)
D08074 Penbutolol (INN)
D08078 Indenolol (INN)
D08090 Isoprenaline (INN)
D08092 Isoxsuprine (INN); Dilator (TN)
D08093 Isoxsuprine lactate; Duphaspasmin [veterinary] (TN)
D08106 Labetalol (INN)
D08115 Levobunolol (INN)
D08124 Levosalbutamol (INN)
D08206 Methylephedrine (BAN)
D08284 Norepinephrine hydrochoride; (-)-Noradrenaline hydrochloride; Arterenol (TN)
D08300 Orciprenaline (INN); Metaproterenol
D08318 Oxprenolol (INN); Oxprenolol (TN)
D08387 Pirbuterol (INN)
D08424 Procaterol (INN); Meptin (TN)
D08443 Propranolol (INN); Propranolol (TN)
D08449 Pseudoephedrine (INN); Neodurasina (TN); Acunaso (TN)
D08474 Reproterol (INN)
D08525 Sotalol (INN); Darob mite (TN)
D08570 Terbutaline (INN); Asthmasian (TN)
D08572 Tertatolol hydrochloride; Artex (TN)
D08598 Tilisolol (INN)
D08600 Timolol (INN); Timolol (TN); Betimol (TN)
D08629 Tretoquinol (INN)
D08945 Milveterol hydrochloride (USAN)
D09318 Indacaterol (USAN/INN)
D09319 Indacaterol maleate (JAN/USAN); Arcapta neohaler (TN)
D09696 Vilanterol (USAN)
D09697 Vilanterol trifenatate (JAN/USAN)
D09794 Norepinephrine hydrochloride (JAN); (+/-)-Noradrenaline hydrochloride
D09842 dl-Methylephedrine saccharinate (JAN)
D09843 Beradilol monoethyl maleate (JAN); TZC-5665
D10020 Olodaterol hydrochloride (JAN/USAN)
D10145 Olodaterol (USAN/INN)
D10219 abediterol (USAN/INN)
D10220 Abediterol napadisylate (USAN)
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Hydroxylation
ReferencePubMed
"Oxygen-regulated beta(2)-adrenergic receptor hydroxylation by EGLN3and ubiquitylation by pVHL.";
Xie L., Xiao K., Whalen E.J., Forrester M.T., Freeman R.S., Fong G.,Gygi S.P., Lefkowitz R.J., Stamler J.S.;
Sci. Signal. 2:RA33-RA33(2009).
Cited for: INTERACTION WITH EGLN3 AND VHL, SUBCELLULAR LOCATION, INDUCTION,UBIQUITINATION, HYDROXYLATION AT PRO-382 AND PRO-395, AND MASSSPECTROMETRY.
Palmitoylation
ReferencePubMed
"Palmitoylation of the human beta 2-adrenergic receptor. Mutation ofCys341 in the carboxyl tail leads to an uncoupled nonpalmitoylatedform of the receptor.";
O'Dowd B.F., Hnatowich M., Caron M.G., Lefkowitz R.J., Bouvier M.;
J. Biol. Chem. 264:7564-7569(1989).
Cited for: PALMITOYLATION AT CYS-341, AND MUTAGENESIS OF CYS-341.
"The palmitoylation state of the beta(2)-adrenergic receptor regulatesthe synergistic action of cyclic AMP-dependent protein kinase andbeta-adrenergic receptor kinase involved in its phosphorylation anddesensitization.";
Moffett S., Rousseau G., Lagace M., Bouvier M.;
J. Neurochem. 76:269-279(2001).
Cited for: EFFECT OF PALMITOYLATION, PHOSPHORYLATION AT SER-345 AND SER-346, ANDMUTAGENESIS OF 345-SER-SER-346.
Phosphorylation
ReferencePubMed
"Mutation of tyrosine-141 inhibits insulin-promoted tyrosinephosphorylation and increased responsiveness of the human beta 2-adrenergic receptor.";
Valiquette M., Parent S., Loisel T.P., Bouvier M.;
EMBO J. 14:5542-5549(1995).
Cited for: MUTAGENESIS OF TYR-141; TYR-350; TYR-354 AND TYR-366, ANDPHOSPHORYLATION AT TYR-141.
"The palmitoylation state of the beta(2)-adrenergic receptor regulatesthe synergistic action of cyclic AMP-dependent protein kinase andbeta-adrenergic receptor kinase involved in its phosphorylation anddesensitization.";
Moffett S., Rousseau G., Lagace M., Bouvier M.;
J. Neurochem. 76:269-279(2001).
Cited for: EFFECT OF PALMITOYLATION, PHOSPHORYLATION AT SER-345 AND SER-346, ANDMUTAGENESIS OF 345-SER-SER-346.
"ATM and ATR substrate analysis reveals extensive protein networksresponsive to DNA damage.";
Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III,Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N.,Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.;
Science 316:1160-1166(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-246, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures