Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Aldo-keto reductase family 1 member C1  

UniProtKB / Swiss-Prot ID :  AK1C1_HUMAN

Gene Name (Synonyms) : 
AKR1C1, DDH, DDH1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Converts progesterone to its inactive form, 20-alpha- dihydroxyprogesterone (20-alpha-OHP). In the liver and intestine, may have a role in the transport of bile. May have a role in monitoring the intrahepatic bile acid concentration. Has a low bile-binding ability. May play a role in myelin formation. 

Protein Sequence MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIA...
Predicted Secondary Structure CCCCCCEEEECCCCEEEEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEECHHHHCCHHHHHHHHHHHHH...
Protein Variant
LocationDescription
170R -> H (in dbSNP:rs17295755). VAR_048214
172Q -> L (in dbSNP:rs17354444). VAR_048215
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
5PhosphotyrosineMDSKYQCVK
CCCCCCEEE
15.88Phosphositeplus
Link
24PhosphotyrosineGFGTYAPAE
EEEECCCCC
15.80Phosphositeplus
Link
55PhosphotyrosineSAHLYNNEE
CHHHHCCHH
13.18Phosphositeplus
Link
81PhosphotyrosineEDIFYTSKL
EEEEEEEEC
15.50Phosphositeplus
Link
196PhosphotyrosineECHPYFNQR
ECCCCCCCH
7.47Phosphositeplus
Link
270N6-acetyllysineVVLAKSYNE
EEEECCCCH
49.68Phosphositeplus
Link
305PhosphotyrosineRNVRYLTLD
CCCCCCCCH
10.35Phosphositeplus
Link
317PhosphotyrosineGPPNYPFSD
CCCCCCCCC
16.07Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
AK1C1_HUMANin vitroHPRD:07194HPRD11514561
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00945Acetylsalicylic acid
DB00936Salicylic acid
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures