Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Aldo-keto reductase family 1 member C3  

UniProtKB / Swiss-Prot ID :  AK1C3_HUMAN

Gene Name (Synonyms) : 
AKR1C3, DDH1, HSD17B5, KIAA0119, PGFS  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Catalyzes the conversion of aldehydes and ketones to alcohols. Catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ) and the oxidation of 9-alpha,11-beta- PGF2 to PGD2. Functions as a bi-directional 3-alpha-, 17-beta- and 20-alpha HSD. Can interconvert active androgens, estrogens and progestins with their cognate inactive metabolites. Preferentially transforms androstenedione (4-dione) to testosterone. 

Protein Sequence MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIA...
Predicted Secondary Structure CCCCCCEEEECCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEECHHHHCCHHHHHHHHHHHHH...
Protein Variant
LocationDescription
5H -> Q (in dbSNP:rs12529). VAR_013288
66R -> Q (in dbSNP:rs35961894). VAR_032767
77E -> G (in dbSNP:rs41306308). VAR_061001
170R -> C (in dbSNP:rs35575889). VAR_032768
175M -> I (no effect on 17beta-HSD activity;dbSNP:rs1131132).
180P -> S (in dbSNP:rs34186955). VAR_032769
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
55PhosphotyrosineSAHLYNNEE
CHHHHCCHH
13.18Phosphositeplus
Link
81PhosphotyrosineEDIFYTSKL
CEEEEEEEE
15.50Phosphositeplus
Link
209N6-acetyllysineFCKSKDIVL
HHHHCCCEE
36.65HPRD
Link
209N6-acetyllysineFCKSKDIVL
HHHHCCCEE
36.65Phosphositeplus
Link
246N6-acetyllysineCALAKKHKR
HHHHHHHCC
57.15HPRD
Link
270N6-acetyllysineVVLAKSYNE
EEEECCCCH
49.68Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
UBE2W_HUMANphysical interactionMINT-63740MINT16169070
CA103_HUMANphysical interactionMINT-63741MINT16169070
UBE2W_HUMANphysical interactionEBI-733804
intact16169070
RIF1_HUMANphysical interactionEBI-729471
intact16169070
ACINU_HUMANphysical interactionEBI-736283
intact16169070
ZHX1_HUMANphysical interactionEBI-731173
intact16169070
CA103_HUMANyeast 2-hybridHPRD:04911HPRD16169070
ACINU_HUMANyeast 2-hybridHPRD:04911HPRD16169070
UBE2W_HUMANyeast 2-hybridHPRD:04911HPRD16169070
ZHX1_HUMANyeast 2-hybridHPRD:04911HPRD16169070
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00905Bimatoprost
DB00997Doxorubicin
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures