Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Aldehyde dehydrogenase family 1 member A3  

UniProtKB / Swiss-Prot ID :  AL1A3_HUMAN

Gene Name (Synonyms) : 
ALDH1A3, ALDH6  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm (By similarity). 

Protein Function :  Recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. Seems to be the key enzyme in the formation of an RA gradient along the dorso-ventral axis during the early eye development and also in the development of the olfactory system (By similarity). 

Protein Sequence MATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATCNPSTREQICEVEEGDKPD...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCHHCCCCCCCCCCCCCCEEECCEEECCCCCCEEEEECCCCCCEEEEEECCCHHH...
Protein Variant
LocationDescription
386M -> V (in dbSNP:rs3803430). VAR_019706
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MATANG
---CCCCCC
18.54UniProtKB
Link-
33Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VKFTKIFIN
CCCCCEEEC
38.46Phosphositeplus
Link-
150Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GWADKIQGK
HCCCCCCCE
29.22Phosphositeplus
Link-
252Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PQINKIAFT
CCCCEEEEC
36.72Phosphositeplus
Link-
263Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TEVGKLVKE
HHHHHHHHH
56.11Phosphositeplus
Link-
266Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GKLVKEAAS
HHHHHHHHH
52.66Phosphositeplus
Link-
278PhosphothreonineLKRVTLELG
CCEEEEECC
20.67Phosphositeplus
Link-
340Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EYAKKRPVG
HHHHHHCCC
54.48Phosphositeplus
Link-
350Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PFDVKTEQG
CCCCCCCCC
48.46Phosphositeplus
Link-
360Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QIDQKQFDK
CCCHHHHHH
49.54Phosphositeplus
Link-
373Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IESGKKEGA
HHHHHHCCC
57.86Phosphositeplus
Link-
394Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GLFIKPTVF
CCEECCEEE
27.57Phosphositeplus
Link-
409Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MRIAKEEIF
HHHHHHHHC
54.21Phosphositeplus
Link-
421Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QPILKFKSI
EEEEEECCH
52.01Phosphositeplus
Link-
423Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ILKFKSIEE
EEEECCHHH
49.27Phosphositeplus
Link-
424PhosphoserineLKFKSIEEV
EEECCHHHH
38.06HPRD
Link-
424PhosphoserineLKFKSIEEV
EEECCHHHH
38.06Phosphositeplus
Link-
430Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EEVIKRANS
HHHHHHHHC
51.11Phosphositeplus
Link-
437PhosphotyrosineNSTDYGLTA
HCCCCCCEE
17.70HPRD
Link-
437PhosphotyrosineNSTDYGLTA
HCCCCCCEE
17.70Phosphositeplus
Link-
440PhosphothreonineDYGLTAAVF
CCCCEEEEE
14.28HPRD
Link-
440PhosphothreonineDYGLTAAVF
CCCCEEEEE
14.28Phosphositeplus
Link-
446Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AVFTKNLDK
EEEECCHHH
44.01Phosphositeplus
Link-
497PhosphotyrosineALAEYTEVK
HHHHHCCCE
11.55Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
COMT_HUMANENSP00000332256STRING
COMT_HUMANENSP00000332256STRING
COMT_HUMANENSP00000332256STRING
BODG_HUMANENSP00000332256STRING
3HIDH_HUMANENSP00000332256STRING
GABT_HUMANENSP00000332256STRING
ALDR_HUMANENSP00000332256STRING
ALDR_HUMANENSP00000332256STRING
ACO12_HUMANENSP00000332256STRING
ACS2L_HUMANENSP00000332256STRING
BUP1_HUMANENSP00000332256STRING
AOFA_HUMANENSP00000332256STRING
MMSA_HUMANENSP00000332256STRING
CNDP1_HUMANENSP00000332256STRING
- top -

Disease Reference
Kegg disease
OMIM disease
615113Microphthalmia, isolated, 8 (MCOP8)
Drug Reference
DrugBank
DB00162Vitamin A
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures