Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Alanine aminotransferase 2  

UniProtKB / Swiss-Prot ID :  ALAT2_HUMAN

Gene Name (Synonyms) : 
GPT2, AAT2, ALT2  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. 

Protein Sequence MQRAAALVRRGCGPRTPSSWGRSQSSAAAEASAVLKVRPERSRRERILTLESMNPQVKAVEYAVRGPIVL...
Predicted Secondary Structure CCCHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEHHCCCHHHHHHHHHHCCCHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
62PhosphotyrosineKAVEYAVRG
HHHHHHHCC
12.09Phosphositeplus
Link
341N6-(pyridoxal phosphate)lysine.HSTSKGYMG
CCHHHHHHH
54.90UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
DLDH_HUMANENSP00000345282STRING
ODPX_HUMANENSP00000345282STRING
GSH1_HUMANENSP00000345282STRING
DCE2_HUMANENSP00000345282STRING
SYAC_HUMANENSP00000345282STRING
KPYR_HUMANENSP00000345282STRING
ODP2_HUMANENSP00000345282STRING
ODPAT_HUMANENSP00000345282STRING
ODPAT_HUMANENSP00000345282STRING
ODPAT_HUMANENSP00000345282STRING
ODPB_HUMANENSP00000345282STRING
GLSL_HUMANENSP00000345282STRING
GLSK_HUMANENSP00000345282STRING
KPYM_HUMANENSP00000345282STRING
KPYM_HUMANENSP00000345282STRING
SYEM_HUMANENSP00000345282STRING
GLNA_HUMANENSP00000345282STRING
DCE1_HUMANENSP00000345282STRING
- top -

Disease Reference
Kegg disease
OMIM disease
616281Mental retardation, autosomal recessive 49 (MRT49)
Drug Reference
DrugBank
DB00160L-Alanine
DB00780Phenelzine
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures