Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Fructose-bisphosphate aldolase B  

UniProtKB / Swiss-Prot ID :  ALDOB_HUMAN

Gene Name (Synonyms) : 
ALDOB, ALDB  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSI...
Predicted Secondary Structure CCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCH...
Protein Variant
LocationDescription
74I -> T (in HFI; affects proper folding). VAR_020822
120Missing (in HFI). VAR_020823
134R -> S (in dbSNP:rs10123355). VAR_038429
135C -> R (in HFI; America; partialactivity).
148W -> R (in one subject with fructoseintolerance; rare variant; America).
150A -> P (in HFI; frequent mutation;dbSNP:rs1800546).
175A -> D (in HFI; frequent mutation). VAR_000554
178C -> R (in HFI). VAR_058211
185P -> R (in HFI). VAR_020824
207E -> Q (in dbSNP:rs3739721). VAR_020825
222V -> F (in HFI; affects proper folding). VAR_020826
229L -> P (in HFI; affects proper folding). VAR_020827
257L -> P (in HFI; Italy). VAR_000555
268I -> N (in dbSNP:rs10989495). VAR_038430
284L -> P (in HFI). VAR_058212
304R -> Q (in HFI; 100-fold decrease incatalytic efficiency for substrates FBP
304R -> W (in HFI; Turkey; 4800-folddecrease in catalytic efficiency for FBP
335N -> K (in HFI; frequent mutation). VAR_000557
338A -> V (in HFI; Turkey and South Europe). VAR_000558
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
36PhosphoserineAADESVGTM
EECCCCCCH
26.79HPRD
Link
36PhosphoserineAADESVGTM
EECCCCCCH
26.79Phosphositeplus
Link
39PhosphothreonineESVGTMGNR
CCCCCHHHH
21.54HPRD
Link
39PhosphothreonineESVGTMGNR
CCCCCHHHH
21.54Phosphositeplus
Link
123PhosphothreonineTNKETTIQG
CCCCCCCCC
30.70HPRD
Link
123PhosphothreonineTNKETTIQG
CCCCCCCCC
30.70Phosphositeplus
Link
123PhosphothreonineTNKETTIQG
CCCCCCCCC
30.70SysPTM
Link
124PhosphothreonineNKETTIQGL
CCCCCCCCH
16.64HPRD
Link
124PhosphothreonineNKETTIQGL
CCCCCCCCH
16.64Phosphositeplus
Link
124PhosphothreonineNKETTIQGL
CCCCCCCCH
16.64SysPTM
Link
147N6-acetyllysineVDFGKWRAV
CCCEEEEEE
33.24Phosphositeplus
Link
204PhosphotyrosineEHCQYVTEK
HHHHHHHHH
18.09Phosphositeplus
Link
208Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YVTEKVLAA
HHHHHHHHH
32.93Phosphositeplus
Link
269S-nitrosocysteineVPGICFLSG
CCEEEEECC
3.30dbSNO
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
VATE1_HUMANin vitroHPRD:01972HPRD11399750
ALDOB_HUMANin vitroHPRD:01972HPRD11679716
- top -

Disease Reference
Kegg disease
OMIM disease
229600Hereditary fructose intolerance (HFI)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures