Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Fructose-bisphosphate aldolase B  

UniProtKB / Swiss-Prot ID :  ALDOB_MOUSE

Gene Name (Synonyms) : 
Aldob, Aldo2  

Species :  Mus musculus (Mouse). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MAHRFPALTPEQKKELSEIAQRIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFRELLFSVDNSI...
Predicted Secondary Structure CCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHCCCHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAHRFP
---CCCCCC
11.54UniProtKB
Link-
36PhosphoserineAADESVGTM
EECCCCCCH
26.79PhosphoELM
Link-
36PhosphoserineAADESVGTM
EECCCCCCH
26.79Phosphositeplus
Link-
36PhosphoserineAADESVGTM
EECCCCCCH
26.79SysPTM
Link-
36Phosphoserine.AADESVGTM
EECCCCCCH
26.79UniProtKB
Link-
39PhosphothreonineESVGTMGNR
CCCCCHHHH
21.54Phosphositeplus
Link-
39PhosphothreonineESVGTMGNR
CCCCCHHHH
21.54SysPTM
Link-
40Methionine sulfoneSVGTMGNRL
CCCCHHHHH
3.54SysPTM
Link-
161PhosphoserineQCPSSLAIQ
CCCHHHHHH
13.63Phosphositeplus
Link-
204PhosphotyrosineEHCQYVSEK
HHHHHHHHH
16.02Phosphositeplus
Link-
204PhosphotyrosineEHCQYVSEK
HHHHHHHHH
16.02SysPTM
Link-
206PhosphoserineCQYVSEKVL
HHHHHHHHH
27.11Phosphositeplus
Link-
206PhosphoserineCQYVSEKVL
HHHHHHHHH
27.11SysPTM
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Large-scale phosphorylation analysis of mouse liver.";
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-36, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures