Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Aldose reductase  

UniProtKB / Swiss-Prot ID :  ALDR_BOVIN

Gene Name (Synonyms) : 
AKR1B1  

Species :  Bos taurus (Bovine). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols with a broad range of catalytic efficiencies. 

Protein Sequence AHNIVLYTGAKMPILGLGTWKSPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLALQAKLQEQVVKRE...
Predicted Secondary Structure CCEEEECCCCEECEEEEEEECCCHHHHHHHHHHHHHCCCCEEECHHHHCCHHHHHHHHHHHHHCCCCCCC...
Protein Variant
LocationDescription
4I -> L.
6L -> I.
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
1N-acetylalanine.----AHNIV
----CCEEE
18.75UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Sequence analysis of bovine lens aldose reductase.";
Schade S.Z., Early S.L., Williams T.R., Kezdy F.J., Heinrikson R.L.,Grimshaw C.E., Doughty C.C.;
J. Biol. Chem. 265:3628-3635(1990).
Cited for: PROTEIN SEQUENCE.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures