Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Aldose reductase  

UniProtKB / Swiss-Prot ID :  ALDR_PIG

Gene Name (Synonyms) : 
AKR1B1, ALR2  

Species :  Sus scrofa (Pig). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols with a broad range of catalytic efficiencies. 

Protein Sequence MASHLVLYTGAKMPILGLGTWKSPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKLQGQVVKR...
Predicted Secondary Structure CCCEEECCCCCEEEEEEEEEECCCHHHHHHHHHHHHHCCCCEEECHHHHCCHHHHHHHHHHHHCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MASHLV
---CCCEEE
12.98UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Sequence of pig lens aldose reductase and electrospray massspectrometry of non-covalent and covalent complexes.";
Jaquinod M., Potier N., Klarskov K., Reymann J.-M., Sorokine O.,Kieffer S., Barth P., Andriantomanga V., Biellmann J.-F.,van Dorsselaer A.;
Eur. J. Biochem. 218:893-903(1993).
Cited for: PROTEIN SEQUENCE OF 2-316, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures