Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Alliin lyase 1  

UniProtKB / Swiss-Prot ID :  ALLN1_ALLSA

Gene Name (Synonyms) :  -
 

Species :  Allium sativum (Garlic). 

Subcellular Localization :  Vacuole. 

Protein Function :  Able to cleave the C-S bond of sulfoxide derivatives of Cys to produce allicin, thus giving rise to all sulfur compounds which are responsible for most of the properties of garlic, such as the specific smell and flavor as well as the health benefits like blood lipid or blood pressure lowering. 

Protein Sequence MVESYKKIGSCNKMPCLVILTCIIMSNSLVNNNNMVQAKMTWTMKAAEEAEAVANINCSEHGRAFLDGII...
Predicted Secondary Structure CCCCHHHHCCCCCCHHHHHHHHHHHHHHEECCCCEEEEEEEEEEECHHHHHHHHCCCCCCCCHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
184N-linked (GlcNAc...).SLSPNMTAT
EECCCCCCC
36.74UniProtKB
Link
289N6-(pyridoxal phosphate)lysine.FTMSKFTGH
EEECCCCCC
35.80UniProtKB
Link
366N-linked (GlcNAc...).ERWVNITAL
HHHHHHHHH
20.95UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures