Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  FAD-linked sulfhydryl oxidase ALR  

UniProtKB / Swiss-Prot ID :  ALR_HUMAN

Gene Name (Synonyms) : 
GFER, ALR, HERV1, HPO  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Isoform 1: Mitochondrion intermembrane space. Isoform 2: Cytoplasm. Secreted. 

Protein Function :  Isoform 1: FAD-dependent sulfhydryl oxidase. Within the mitochondrial intermembrane space, participates in a chain of disulfide exchange reactions with MIA40, that generate disulfide bonds in a number of resident proteins with twin Cx3C and Cx9C motifs. Isoform 2: May act as an autocrine hepatotrophic growth factor promoting liver regeneration. 

Protein Sequence MAAPGERGRFHGGNLFFLPGGARSEMMDDLATDARGRGAGRRDAAASASTPAQAPTSDSPVAEDASRRRP...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHH...
Protein Variant
LocationDescription
166F -> L (in dbSNP:rs36041021). VAR_061994
194R -> H (in MPMCHD; less stable than thewild-type protein within the
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
56PhosphothreonineAQAPTSDSP
HHHHHHHHC
48.45HPRD
Link-
57PhosphoserineQAPTSDSPV
HHHHHHHCC
34.72HPRD
Link-
59PhosphoserinePTSDSPVAE
HHHHHCCCH
22.50HPRD
Link-
59PhosphoserinePTSDSPVAE
HHHHHCCCH
22.50Phosphositeplus
Link-
59Phosphoserine.PTSDSPVAE
HHHHHCCCH
22.50UniProtKB
Link-
78Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)CVDFKTWMR
HCCCCCCCC
36.49Phosphositeplus
Link-
142S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)KFYPCEECA
4.72HPRD
Link
145S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)PCEECAEDL
2.04HPRD
Link
165S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)RTRACFTQW
3.23HPRD
Link
171S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)TQWLCHLHN
2.67HPRD
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
BNIPL_HUMANphysical interactionMINT-15741MINT12681488
BNIPL_HUMANphysical interactionMINT-15743MINT12681488
BNIPL_HUMANphysical interactionMINT-15742MINT12681488
ALR_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:02954HPRD12180965
15304329
ASCC2_HUMANyeast 2-hybridHPRD:02954HPRD16169070
INS_HUMANENSP00000248114STRING
INS_HUMANENSP00000248114STRING
IBP3_HUMANENSP00000248114STRING
IBP1_HUMANENSP00000248114STRING
VEGFA_HUMANENSP00000248114STRING
IGF2_HUMANENSP00000248114STRING
- top -

Disease Reference
Kegg disease
OMIM disease
613076Myopathy, mitochondrial progressive, with congenital cataract, hearing loss and developmental delay (MPMCHD)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"A quantitative atlas of mitotic phosphorylation.";
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-59, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures