Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Alpha-amylase 1  

UniProtKB / Swiss-Prot ID :  AMY1_HUMAN

Gene Name (Synonyms) : 
AMY1A, AMY1
AMY1B, AMY1
AMY1C, AMY1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Secreted. 

Protein Function :   

Protein Sequence MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPF...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
16Pyrrolidone carboxylic acid.FCWAQYSSN
17.72UniProtKB
Link
189PhosphotyrosineLGKDYVRSK
10.97HPRD
Link
365Deamidated asparagine; partial.RYFENGKDV
53.57UniProtKB
Link
427Deamidated asparagine; partial.NWYDNGSNQ
39.84UniProtKB
Link
427N-linked (Glc...)NWYDNGSNQ
39.84HPRD
Link
427N-linked (GlcNAc...).NWYDNGSNQ
39.84UniProtKB
Link
474Deamidated asparagine; partial.GDKINGNCT
41.17UniProtKB
Link
476N-linked (Glc...)KINGNCTGI
18.71HPRD
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
AKAP8_HUMANin vitro
in vivo
HPRD:00096HPRD12414807
MUC7_HUMANyeast 2-hybridHPRD:00096HPRD16203048
AKAP1_HUMANin vitro
in vivo
HPRD:00096HPRD12414807
AMYP_HUMANENSP00000330484STRING
AMYP_HUMANENSP00000330484STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"Identification of N-linked glycoproteins in human saliva byglycoprotein capture and mass spectrometry.";
Ramachandran P., Boontheung P., Xie Y., Sondej M., Wong D.T.,Loo J.A.;
J. Proteome Res. 5:1493-1503(2006).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-427, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures