Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glucoamylase  

UniProtKB / Swiss-Prot ID :  AMYG_ASPAW

Gene Name (Synonyms) : 
GLAA  

Species :  Aspergillus awamori (Black koji mold). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MSFRSLLALSGLVCTGLANVISKRATLDSWLSNEATVARTAILNNIGADGAWVSGADSGIVVASPSTDNP...
Predicted Secondary Structure CCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
195N-linked (GlcNAc...).AQYWNQTGY
HHHCCCCCC
25.30UniProtKB
Link
419N-linked (GlcNAc...).HAASNGSMS
HHCCCCCCC
41.66UniProtKB
Link
467O-linked (Man).ETSASSVPG
CCCCCCCCC
31.47UniProtKB
Link
468O-linked (Man).TSASSVPGT
CCCCCCCCC
31.86UniProtKB
Link
476O-linked (Man).TCAATSAIG
CEEEECCCC
10.52UniProtKB
Link
477O-linked (Man).CAATSAIGT
EEEECCCCE
17.11UniProtKB
Link
483O-linked (Man).IGTYSSVTV
CCEEEEEEE
20.40UniProtKB
Link
484O-linked (Man).GTYSSVTVT
CEEEEEEEE
16.05UniProtKB
Link
486O-linked (Man).YSSVTVTSW
EEEEEEECC
21.73UniProtKB
Link
488O-linked (Man).SVTVTSWPS
EEEEECCCE
18.73UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures