Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glucoamylase  

UniProtKB / Swiss-Prot ID :  AMYG_ASPNG

Gene Name (Synonyms) : 
GLAA  

Species :  Aspergillus niger. 

Subcellular Localization :   

Protein Function :   

Protein Sequence MSFRSLLALSGLVCTGLANVISKRATLDSWLSNEATVARTAILNNIGADGAWVSGADSGIVVASPSTDNP...
Predicted Secondary Structure CCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
465O-linked (Man).WGETSASSV
CCCCCCCCC
23.11UniProtKB
Link-
467O-linked (Man).ETSASSVPG
CCCCCCCCC
31.47UniProtKB
Link-
468O-linked (Man).TSASSVPGT
CCCCCCCCC
31.86UniProtKB
Link-
476O-linked (Man).TCAATSAIG
CEEEECCCC
10.52UniProtKB
Link-
477O-linked (Man).CAATSAIGT
EEEECCCCE
17.11UniProtKB
Link-
483O-linked (Man).IGTYSSVTV
CCEEEEEEE
20.40UniProtKB
Link-
484O-linked (Man).GTYSSVTVT
CEEEEEEEE
16.05UniProtKB
Link-
486O-linked (Man).YSSVTVTSW
EEEEEEECC
21.73UniProtKB
Link-
488O-linked (Man).SVTVTSWPS
EEEEECCCE
18.73UniProtKB
Link-
489O-linked (Man).VTVTSWPSI
EEEECCCEE
32.43UniProtKB
Link-
492O-linked (Man).TSWPSIVAT
ECCCEEEEC
24.36UniProtKB
Link-
496O-linked (Man).SIVATGGTT
EEEECCCEE
25.83UniProtKB
Link-
499O-linked (Man).ATGGTTTTA
ECCCEEEEE
23.47UniProtKB
Link-
500O-linked (Man).TGGTTTTAT
CCCEEEEEE
25.98UniProtKB
Link-
501O-linked (Man).GGTTTTATP
CCEEEEEEC
17.80UniProtKB
Link-
502O-linked (Man).GTTTTATPT
CEEEEEECC
26.83UniProtKB
Link-
504O-linked (Man).TTTATPTGS
EEEEECCCC
21.20UniProtKB
Link-
506O-linked (Man).TATPTGSGS
EEECCCCCC
39.36UniProtKB
Link-
508O-linked (Man).TPTGSGSVT
ECCCCCCCE
30.30UniProtKB
Link-
510O-linked (Man).TGSGSVTST
CCCCCCEEE
24.74UniProtKB
Link-
512O-linked (Man).SGSVTSTSK
CCCCEEEEE
28.16UniProtKB
Link-
513O-linked (Man).GSVTSTSKT
CCCEEEEEE
28.64UniProtKB
Link-
514O-linked (Man).SVTSTSKTT
CCEEEEEEE
25.52UniProtKB
Link-
515O-linked (Man).VTSTSKTTA
CEEEEEEEE
27.98UniProtKB
Link-
517O-linked (Man).STSKTTATA
EEEEEEECC
22.79UniProtKB
Link-
518O-linked (Man).TSKTTATAS
EEEEEECCC
26.25UniProtKB
Link-
520O-linked (Man).KTTATASKT
EEEECCCCC
29.40UniProtKB
Link-
522O-linked (Man).TATASKTST
EECCCCCCC
31.92UniProtKB
Link-
524O-linked (Man).TASKTSTST
CCCCCCCCC
34.44UniProtKB
Link-
525O-linked (Man).ASKTSTSTS
CCCCCCCCC
24.89UniProtKB
Link-
526O-linked (Man).SKTSTSTSS
CCCCCCCCC
41.05UniProtKB
Link-
527O-linked (Man).KTSTSTSST
CCCCCCCCC
26.51UniProtKB
Link-
528O-linked (Man).TSTSTSSTS
CCCCCCCCC
27.13UniProtKB
Link-
529O-linked (Man).STSTSSTSC
CCCCCCCCC
31.24UniProtKB
Link-
530O-linked (Man).TSTSSTSCT
CCCCCCCCC
25.16UniProtKB
Link-
531O-linked (Man).STSSTSCTT
CCCCCCCCC
27.82UniProtKB
Link-
532O-linked (Man).TSSTSCTTP
CCCCCCCCC
16.06UniProtKB
Link
534O-linked (Man).STSCTTPTA
CCCCCCCCE
35.26UniProtKB
Link
535O-linked (Man).TSCTTPTAV
CCCCCCCEE
23.99UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures