Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Pancreatic alpha-amylase  

UniProtKB / Swiss-Prot ID :  AMYP_HUMAN

Gene Name (Synonyms) : 
AMY2A  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Secreted, extracellular space. 

Protein Function :   

Protein Sequence MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPF...
Predicted Secondary Structure CHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
16Pyrrolidone carboxylic acid.FCWAQYSPN
HHHHHCCCC
18.10UniProtKB
Link
189PhosphotyrosineLEKDYVRSK
CCCHHHHHH
14.61Phosphositeplus
Link
476N-linked (GlcNAc...).KINGNCTGI
EECCCCCCE
18.71UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
PYGM_HUMANENSP00000306915STRING
PYGL_HUMANENSP00000306915STRING
PYGB_HUMANENSP00000306915STRING
GLGB_HUMANENSP00000306915STRING
SUIS_HUMANENSP00000306915STRING
GP2_HUMANENSP00000306915STRING
GDE_HUMANENSP00000306915STRING
MGA_HUMANENSP00000306915STRING
AMY1_HUMANENSP00000306915STRING
AMY1_HUMANENSP00000306915STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures