Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Antithrombin-III  

UniProtKB / Swiss-Prot ID :  ANT3_HUMAN

Gene Name (Synonyms) : 
SERPINC1, AT3 PRO0309  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Secreted, extracellular space. 

Protein Function :  Most important serine protease inhibitor in plasma that regulates the blood coagulation cascade. AT-III inhibits thrombin, matriptase-3/TMPRSS7, as well as factors IXa, Xa and XIa. Its inhibitory activity is greatly enhanced in the presence of heparin. 

Protein Sequence MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQ...
Predicted Secondary Structure CCCCCCCEECCCCCEEHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCC...
Protein Variant
LocationDescription
17Y -> S (in AT3D; type-I). VAR_027450
23L -> P (in AT3D; type-I; impairscotranslational processing).
30V -> E (in Dublin; dbSNP:rs2227624). VAR_007032
32C -> R (in AT3D; type-I). VAR_027451
39I -> N (in AT3D; type-II; Rouen-3; lackof heparin-binding properties;
52M -> T (previously Whitechapel). VAR_007034
56R -> C (in AT3D; type-II; Rouen-4; lackof heparin-binding properties;
73P -> L (in AT3D; type-II; Basel/Franconville/Clichy-1/Clichy-2/Dublin-2;
79R -> C (in AT3D; Tours/Alger/Amiens/Toyama/Paris-1/Paris-2/Padua-2/Barcelona-
79R -> H (in AT3D; type-II; Rouen-1/Padua-1/Bligny/Budapest-2; lack of heparin-
79R -> S (in AT3D; type-II; Rouen-2; lackof heparin-binding properties).
87Missing (in AT3D; type-I). VAR_007040
89R -> C (in AT3D; type-I). VAR_007041
90F -> L (in AT3D; type-I; Budapest-6). VAR_007042
95Y -> C (in AT3D; type-I). VAR_027452
95Y -> S (in AT3D; type-I). VAR_012316
98L -> P (in AT3D; type-I). VAR_027453
108Missing (in AT3D; type-I). VAR_007043
112P -> T (in AT3D; type-I). VAR_007044
121M -> K (in AT3D; type-I). VAR_027454
127C -> R (in AT3D; type-I). VAR_027455
131L -> F (in AT3D; type-II; Budapest-3/Budapest-7).
131L -> V (in AT3D; type-II; Southport). VAR_007046
133Q -> K (in AT3D; type I). VAR_007047
138Missing (in AT3D; type-I). VAR_007048
146K -> E (in AT3D; Dreux; complete loss afheparin binding).
147T -> A (in dbSNP:rs2227606). VAR_013085
148S -> P (in AT3D; type-II; Nagasaki;defective heparin binding associated with
150Q -> P (in AT3D; type-II; Vienna). VAR_007050
152Missing (in AT3D; type-I). VAR_012749
152H -> Y (in AT3D; type-I). VAR_007051
153Missing (in AT3D; type-I). VAR_007052
158L -> P (in AT3D; type-I). VAR_007053
160C -> Y (in AT3D; type-I). VAR_027457
161R -> Q (in AT3D; type-II; Geneva). VAR_007054
167N -> T. VAR_012750
178L -> H (in AT3D; type-I). VAR_027458
179F -> L (in AT3D; type-I). VAR_027459
190Y -> C (polymorphism in population ofScandinavian origin).
198Y -> C (in AT3D; type-I and -II;Whitechapel).
198Y -> H (in AT3D; type-I). VAR_027460
214S -> F (in AT3D; type-I). VAR_027461
214S -> Y (in AT3D; type-I). VAR_007057
218Missing (in AT3D; type-I). VAR_027462
219N -> D (in AT3D; type-II; Rouen-6;increases affinity for heparin).
219N -> K (in AT3D; type-II; Glasgow-3). VAR_007058
223S -> P (in AT3D; type-I). VAR_027463
243T -> I (in AT3D; type-I). VAR_027464
251I -> T (in AT3D; type-I). VAR_027465
257W -> R (in AT3D; type-I). VAR_027466
261F -> L (in AT3D). VAR_027467
269E -> K (in AT3D; type-II; Truro,increases affinity for heparin).
273Missing (in AT3D; type-I). VAR_007061
283M -> I (in AT3D; type-II). VAR_007062
283M -> V (in AT3D; type-II). VAR_027468
302L -> P (in AT3D; type-I). VAR_007063
316I -> N (in AT3D; type-II; Haslar/Whitechapel).
323S -> P (in AT3D). VAR_027469
334E -> K (in AT3D; type-II). VAR_007065
344Missing (in AT3D; type-I). VAR_007066
381S -> P (in AT3D; type-I). VAR_007067
391R -> Q. VAR_007068
397S -> P (in AT3D; type-I). VAR_027470
398D -> H (in AT3D; type-I). VAR_027471
412S -> R (in AT3D; type-I). VAR_027472
414A -> T (in AT3D; type-II; Hamilton/Glasgow-2; reduces interaction with
416A -> P (in AT3D; type-II; Charleville/Sudbury/Vicenza/Cambridge-1;
416A -> S (in AT3D; type-II; Cambridge-2). VAR_007071
419A -> V (in AT3D; type-I). VAR_007072
424G -> D (in AT3D; type-II; Stockholm). VAR_007073
425R -> C (in AT3D; type-II; Northwick-Park/Milano-1/Frankfurt-1; deprived of
425R -> H (in AT3D; type-II; Glasgow/Sheffield/Chicago/Avranches/Kumamoto-2;
425R -> P (in AT3D; type-II; Pescara;deprived of inhibitory of activity).
426S -> L (in AT3D; type-II; Denver/Milano-2; deprived of inhibitory activity).
434F -> C (in AT3D; type-II; Rosny). VAR_007078
434F -> L (in AT3D; type-II; Maisons-Laffite).
434F -> S (in AT3D; type-II; Torino). VAR_007079
436A -> T (in AT3D; type-II; Oslo/Paris-3). VAR_007081
437N -> K (in AT3D; type-II; La Rochelle). VAR_007082
438R -> G (in AT3D; type-II). VAR_009258
438R -> M (in AT3D; type-II; Kyoto). VAR_007083
439P -> L (in AT3D; type-II; Utah; deprivedof inhibitory activity).
439P -> T (in AT3D; type-II; Budapest-5). VAR_007085
441L -> P (in AT3D; type-II). VAR_027473
453I -> T (in AT3D; type-I). VAR_007086
456G -> R (in AT3D; type-I). VAR_007087
457R -> T (in AT3D; type-II). VAR_007088
459Missing (in AT3D; type-I). VAR_007089
459A -> D (in AT3D; type-I). VAR_007090
461P -> L (in AT3D; type-II; Budapest). VAR_007091
462C -> F (in AT3D; type-I). VAR_007092
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
35O-linked (Man)TCHGSPVDI
CCCCCCCCC
9.70OGlycBase
Link-
40S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)PVDICTAKP
CCCCCCCCC
2.34HPRD
Link-
41O-linked (Man)VDICTAKPR
CCCCCCCCC
37.74OGlycBase
Link-
53S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)MNPMCIYRS
CCCCEEECC
2.33HPRD
Link
63PhosphothreonineEKKATEDEG
CCCCCCCCC
53.50HPRD
Link-
63PhosphothreonineEKKATEDEG
CCCCCCCCC
53.50Phosphositeplus
Link-
68PhosphoserineEDEGSEQKI
CCCCCCCCC
34.50HPRD
Link-
68PhosphoserineEDEGSEQKI
CCCCCCCCC
34.50Phosphositeplus
Link-
68Phosphoserine.EDEGSEQKI
CCCCCCCCC
34.50UniProtKB
Link-
127S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)KLGACNDTL
HCCCCHHHH
4.49HPRD
Link
128N-linked (Glc...)LGACNDTLQ
CCCCHHHHH
44.78HPRD
Link
128N-linked (Glc...)LGACNDTLQ
CCCCHHHHH
44.78OGlycBase
Link
128N-linked (GlcNAc...).LGACNDTLQ
CCCCHHHHH
44.78UniProtKB
Link
160S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)AKLNCRLYR
HHHHHHHCC
4.61HPRD
Link
167N-linked (Glc...)YRKANKSSK
CCCCCCCCE
48.02HPRD
Link
167N-linked (Glc...)YRKANKSSK
CCCCCCCCE
48.02OGlycBase
Link
167N-linked (GlcNAc...).YRKANKSSK
CCCCCCCCE
48.02UniProtKB
Link
174PhosphoserineSKLVSANRL
CEEEEEEEE
30.20HPRD
Link
174PhosphoserineSKLVSANRL
CEEEEEEEE
30.20Phosphositeplus
Link
187N-linked (Glc...)SLTFNETYQ
CCCCCHHHH
35.15HPRD
Link
187N-linked (Glc...)SLTFNETYQ
CCCCCHHHH
35.15OGlycBase
Link
187N-linked (GlcNAc...)SLTFNETYQ
CCCCCHHHH
35.15SysPTM
Link
187N-linked (GlcNAc...) (complex).SLTFNETYQ
CCCCCHHHH
35.15UniProtKB
Link
224N-linked (Glc...)KWVSNKTEG
HHHHHHHCC
45.72HPRD
Link
224N-linked (Glc...)KWVSNKTEG
HHHHHHHCC
45.72OGlycBase
Link
224N-linked (GlcNAc...)KWVSNKTEG
HHHHHHHCC
45.72SysPTM
Link
224N-linked (GlcNAc...).KWVSNKTEG
HHHHHHHCC
45.72UniProtKB
Link
279S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)DGESCSASM
CCEEEEEEE
3.24HPRD
Link
425noneVIAGRSLNP
EEECCCCCC
29.02HPRD
Link
462S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)VANPCVK
ECCCCCC
6.47HPRD
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
THRB_HUMANphysical interaction
physical interaction
EBI-1039853
EBI-1039853
intact15311269
15311269
ANT3_HUMANin vitroHPRD:00122HPRD9405673
9067613
10809774
- top -

Disease Reference
Kegg disease
OMIM disease
613118Antithrombin III deficiency (AT3D)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"A proteomic analysis of human bile.";
Kristiansen T.Z., Bunkenborg J., Gronborg M., Molina H.,Thuluvath P.J., Argani P., Goggins M.G., Maitra A., Pandey A.;
Mol. Cell. Proteomics 3:715-728(2004).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-187, AND MASSSPECTROMETRY.
"Screening for N-glycosylated proteins by liquid chromatography massspectrometry.";
Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R.;
Proteomics 4:454-465(2004).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-128 AND ASN-187, AND MASSSPECTROMETRY.
"Human plasma N-glycoproteome analysis by immunoaffinity subtraction,hydrazide chemistry, and mass spectrometry.";
Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E.,Moore R.J., Smith R.D.;
J. Proteome Res. 4:2070-2080(2005).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-128; ASN-187 AND ASN-224,AND MASS SPECTROMETRY.
"Elucidation of N-glycosylation sites on human platelet proteins: aglycoproteomic approach.";
Lewandrowski U., Moebius J., Walter U., Sickmann A.;
Mol. Cell. Proteomics 5:226-233(2006).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-224, AND MASSSPECTROMETRY.
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry.";
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
J. Proteome Res. 8:651-661(2009).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-128 AND ASN-187, AND MASSSPECTROMETRY.
"Enrichment of glycopeptides for glycan structure and attachment siteidentification.";
Nilsson J., Rueetschi U., Halim A., Hesse C., Carlsohn E.,Brinkmalm G., Larson G.;
Nat. Methods 6:809-811(2009).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-187, STRUCTURE OFCARBOHYDRATES, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"An initial characterization of the serum phosphoproteome.";
Zhou W., Ross M.M., Tessitore A., Ornstein D., Vanmeter A.,Liotta L.A., Petricoin E.F. III;
J. Proteome Res. 8:5523-5531(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-68, TISSUE SPECIFICITY,AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures