Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Annexin A1  

UniProtKB / Swiss-Prot ID :  ANXA1_PIG

Gene Name (Synonyms) : 
ANXA1, ANX1  

Species :  Sus scrofa (Pig). 

Subcellular Localization :  Nucleus (By similarity). Cytoplasm (By similarity). Cell projection, cilium (By similarity). Basolateral cell membrane (By similarity). Note=Found in the cilium, nucleus and basolateral cell membrane of ciliated cells in the tracheal endothelium (By simi 

Protein Function :  Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis. This protein regulates phospholipase A2 activity. It seems to bind from two to four calcium ions with high affinity. 

Protein Sequence MAMVSEFLKQAWFIDNEEQEYIKTVKGSKGGPGSAVSPYPTFNPSSDVEASHKAITVKGVDEATIIEIHT...
Predicted Secondary Structure CCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
21Phosphotyrosine (EGFR)EEQEYIKTV
HHHHHHHHH
13.86PhosphoELM
Link
21Phosphotyrosine; by EGFR.EEQEYIKTV
HHHHHHHHH
13.86UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"A calcium-dependent 35-kilodalton substrate for epidermal growthfactor receptor/kinase isolated from normal tissue.";
De B.K., Misono K.S., Lukas T.J., Mroczkowski B., Cohen S.;
J. Biol. Chem. 261:13784-13792(1986).
Cited for: PROTEIN SEQUENCE OF 13-42, AND PHOSPHORYLATION AT TYR-21 BY EGFR.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures