Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Annexin A3  

UniProtKB / Swiss-Prot ID :  ANXA3_HUMAN

Gene Name (Synonyms) : 
ANXA3, ANX3  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Inhibitor of phospholipase A2, also possesses anti- coagulant properties. Also cleaves the cyclic bond of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. 

Protein Sequence MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKD...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCHHH...
Protein Variant
LocationDescription
19S -> N (in dbSNP:rs5951). VAR_013914
219I -> N (in dbSNP:rs5948). VAR_013915
251P -> L (in dbSNP:rs5949). VAR_013916
291F -> S (in dbSNP:rs5941). VAR_013917
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MASIWV
---CCCCCC
15.10UniProtKB
Link
29Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EAIQKAIRG
HHHHHHHHH
39.40Phosphositeplus
Link
58Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QLIVKEYQA
HHHHHHHHH
43.65Phosphositeplus
Link
104Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KKSMKGAGT
HHHHCCCCC
53.34Phosphositeplus
Link
176Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EHLAKQDAQ
HHHHHHHHH
55.88Phosphositeplus
Link
184Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QILYKAGEN
HHHHHHHCC
46.61Phosphositeplus
Link
210Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FPQLKLTFD
HHHHHHHHH
39.99Phosphositeplus
Link
263Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)HRALKGIGT
HHHHCCCCC
47.71Phosphositeplus
Link
300PhosphotyrosineGYSLYSAIK
CCCHHHHHH
7.07Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
UBR1_HUMANphysical interactionMINT-63462MINT16169070
IGS21_HUMANphysical interactionEBI-731185
intact16169070
P53_HUMANphysical interactionEBI-729483
intact16169070
UBR1_HUMANphysical interactionEBI-729486
intact16169070
UN119_HUMANphysical interactionEBI-729489
intact16169070
P53_HUMANyeast 2-hybridHPRD:00111HPRD16169070
UN119_HUMANyeast 2-hybridHPRD:00111HPRD16169070
UBR1_HUMANyeast 2-hybridHPRD:00111HPRD16169070
IGS21_HUMANyeast 2-hybridHPRD:00111HPRD16169070
NEP1_HUMANyeast 2-hybridHPRD:00111HPRD16169070
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures